Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TNFRSF18 monoclonal antibody (M03), clone 2H4. Western Blot analysis of TNFRSF18 expression in Hela S3 NE.)

Mouse TNFRSF18 Monoclonal Antibody | anti-TNFRSF18 antibody

TNFRSF18 (Tumor Necrosis Factor Receptor Superfamily, Member 18, AITR, GITR, GITR-D) (AP)

Gene Names
TNFRSF18; AITR; GITR; CD357; GITR-D
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TNFRSF18; Monoclonal Antibody; TNFRSF18 (Tumor Necrosis Factor Receptor Superfamily; Member 18; AITR; GITR; GITR-D) (AP); Tumor Necrosis Factor Receptor Superfamily; GITR-D; anti-TNFRSF18 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H4
Specificity
Recognizes TNFRSF18.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TNFRSF18 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TNFRSF18 (NP_004186, 26aa-115aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TNFRSF18 monoclonal antibody (M03), clone 2H4. Western Blot analysis of TNFRSF18 expression in Hela S3 NE.)

Western Blot (WB) (TNFRSF18 monoclonal antibody (M03), clone 2H4. Western Blot analysis of TNFRSF18 expression in Hela S3 NE.)

Western Blot (WB)

(TNFRSF18 monoclonal antibody (M03), clone 2H4. Western Blot analysis of TNFRSF18 expression in NIH/3T3.)

Western Blot (WB) (TNFRSF18 monoclonal antibody (M03), clone 2H4. Western Blot analysis of TNFRSF18 expression in NIH/3T3.)
Related Product Information for anti-TNFRSF18 antibody
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]
Product Categories/Family for anti-TNFRSF18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.6kDa (145aa) 18-28KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 18 isoform 1
NCBI Official Synonym Full Names
TNF receptor superfamily member 18
NCBI Official Symbol
TNFRSF18
NCBI Official Synonym Symbols
AITR; GITR; CD357; GITR-D
NCBI Protein Information
tumor necrosis factor receptor superfamily member 18
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 18
UniProt Gene Name
TNFRSF18
UniProt Synonym Gene Names
AITR; GITR
UniProt Entry Name
TNR18_HUMAN

NCBI Description

This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Feb 2011]

Uniprot Description

TNFRSF18: Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Receptor, cytokine

Chromosomal Location of Human Ortholog: 1p36.3

Cellular Component: integral to plasma membrane; extracellular region; external side of plasma membrane

Molecular Function: tumor necrosis factor receptor activity

Biological Process: tumor necrosis factor-mediated signaling pathway; apoptosis; signal transduction; negative regulation of apoptosis

Research Articles on TNFRSF18

Similar Products

Product Notes

The TNFRSF18 tnfrsf18 (Catalog #AAA6164792) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TNFRSF18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFRSF18 tnfrsf18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFRSF18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.