Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TMSB4X Monoclonal Antibody | anti-TMSB4X antibody

TMSB4X (Thymosin beta 4, X-Linked, FX, PTMB4, TB4X, TMSB4) (HRP)

Gene Names
TMSB4X; FX; TB4X; PTMB4; TMSB4
Applications
Western Blot
Purity
Purified
Synonyms
TMSB4X; Monoclonal Antibody; TMSB4X (Thymosin beta 4; X-Linked; FX; PTMB4; TB4X; TMSB4) (HRP); Thymosin beta 4; TMSB4; anti-TMSB4X antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H7
Specificity
Recognizes TMSB4X.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
44
Applicable Applications for anti-TMSB4X antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TMSB4X (NP_066932, 1aa-44aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-TMSB4X antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
thymosin beta-4
NCBI Official Synonym Full Names
thymosin beta 4 X-linked
NCBI Official Symbol
TMSB4X
NCBI Official Synonym Symbols
FX; TB4X; PTMB4; TMSB4
NCBI Protein Information
thymosin beta-4
UniProt Protein Name
Thymosin beta-4
Protein Family
UniProt Gene Name
TMSB4X
UniProt Synonym Gene Names
TB4X; THYB4; TMSB4; T beta-4
UniProt Entry Name
TYB4_HUMAN

NCBI Description

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008]

Uniprot Description

TMSB4X: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Belongs to the thymosin beta family.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: Xq21.3-q22

Cellular Component: cytoskeleton; extracellular region

Molecular Function: actin monomer binding; protein binding

Biological Process: platelet activation; platelet degranulation; sequestering of actin monomers; actin filament organization; blood coagulation

Research Articles on TMSB4X

Similar Products

Product Notes

The TMSB4X tmsb4x (Catalog #AAA6183227) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMSB4X can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TMSB4X tmsb4x for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMSB4X, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.