Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD).)

Mouse anti-Human TMOD3 Monoclonal Antibody | anti-TMOD3 antibody

TMOD3 (Tropomodulin-3, Ubiquitous Tropomodulin, U-Tmod) APC

Gene Names
TMOD3; UTMOD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TMOD3; Monoclonal Antibody; TMOD3 (Tropomodulin-3; Ubiquitous Tropomodulin; U-Tmod) APC; anti-TMOD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E1
Specificity
Recognizes human TMOD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
8232
Applicable Applications for anti-TMOD3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa280-353 from human TMOD3 (NP_055362) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD).)

Western Blot (WB)

(TMOD3 monoclonal antibody. Western Blot analysis of TMOD3 expression in human kidney.)

Western Blot (WB) (TMOD3 monoclonal antibody. Western Blot analysis of TMOD3 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of TMOD3 expression in transfected 293T cell line by TMOD3 monoclonal antibody. Lane 1: TMOD3 transfected lysate (Predicted MW: 39.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TMOD3 expression in transfected 293T cell line by TMOD3 monoclonal antibody. Lane 1: TMOD3 transfected lysate (Predicted MW: 39.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TMOD3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TMOD3 is 1ng/ml as a capture antibody.)
Related Product Information for anti-TMOD3 antibody
Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.
Product Categories/Family for anti-TMOD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tropomodulin 3 (TMOD3), mRNA
NCBI Official Synonym Full Names
tropomodulin 3
NCBI Official Symbol
TMOD3
NCBI Official Synonym Symbols
UTMOD
NCBI Protein Information
tropomodulin-3
UniProt Protein Name
Tropomodulin-3
Protein Family
UniProt Gene Name
TMOD3
UniProt Synonym Gene Names
U-Tmod
UniProt Entry Name
TMOD3_HUMAN

Uniprot Description

TMOD3: Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. Belongs to the tropomodulin family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q21.1-q21.2

Cellular Component: striated muscle thin filament

Molecular Function: actin binding; tropomyosin binding

Biological Process: erythrocyte development; myofibril assembly; muscle contraction; actin filament organization; pointed-end actin filament capping

Research Articles on TMOD3

Similar Products

Product Notes

The TMOD3 tmod3 (Catalog #AAA6139536) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMOD3 (Tropomodulin-3, Ubiquitous Tropomodulin, U-Tmod) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMOD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TMOD3 tmod3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMOD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.