Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Mouse anti-Human TMEFF2 Monoclonal Antibody | anti-TMEFF2 antibody

TMEFF2 (Transmembrane Protein with EGF-like and Two Follistatin-like Domains, TPEF, Tomoregulin-2, TR-2, Hyperplastic Polyposis Protein 1, HPP1, TENB2, UNQ178/PRO204) (HRP)

Gene Names
TMEFF2; TR; HPP1; TPEF; TR-2; TENB2; CT120.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TMEFF2; Monoclonal Antibody; TMEFF2 (Transmembrane Protein with EGF-like and Two Follistatin-like Domains; TPEF; Tomoregulin-2; TR-2; Hyperplastic Polyposis Protein 1; HPP1; TENB2; UNQ178/PRO204) (HRP); CT120.2; TR; anti-TMEFF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D12
Specificity
Recognizes human TMEFF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2799
Applicable Applications for anti-TMEFF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-293 from TMEFF2 (NP_057276) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCD*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)
Product Categories/Family for anti-TMEFF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens transmembrane protein with EGF like and two follistatin like domains 2 (TMEFF2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
transmembrane protein with EGF like and two follistatin like domains 2
NCBI Official Symbol
TMEFF2
NCBI Official Synonym Symbols
TR; HPP1; TPEF; TR-2; TENB2; CT120.2
NCBI Protein Information
tomoregulin-2
Protein Family

NCBI Description

This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Research Articles on TMEFF2

Similar Products

Product Notes

The TMEFF2 (Catalog #AAA6155441) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMEFF2 (Transmembrane Protein with EGF-like and Two Follistatin-like Domains, TPEF, Tomoregulin-2, TR-2, Hyperplastic Polyposis Protein 1, HPP1, TENB2, UNQ178/PRO204) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEFF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TMEFF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEFF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.