Mouse TLR9 Monoclonal Antibody | anti-TLR9 antibody

TLR9 (Toll-like Receptor 9, CD289) (HRP)

Cat. Num. AAA6179735

• Gene Names: TLR9; CD289
• Applications: Western Blot
• Purity: Purified
• Synonyms: TLR9; Monoclonal Antibody; TLR9 (Toll-like Receptor 9; CD289) (HRP); Toll-like Receptor 9; CD289; anti-TLR9 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B7
• Specificity: Recognizes TLR9.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TLR9 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TLR9 (AAH32713, 99aa-215aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TLR9 monoclonal antibody (M04), clone 3B7 Western Blot analysis of TLR9 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(TLR9 monoclonal antibody (M04), clone 3B7 Western Blot analysis of TLR9 expression in IMR-32 (Cat # L008V1).)

Testing Data

(Detection limit for recombinant GST tagged TLR9 is approximately 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TLR9 antibody

Antibodies; Toll Like Receptors (TLR)

NCBI and Uniprot Product Information

• NCBI GI #: 21595773
• NCBI GeneID: 54106
• UniProt Accession #: Q9NR96; Q6UVZ2; Q9HD68; Q9HD69; Q9HD70; Q9NYC2; Q9NYC3; B3Y661; D1CS56
• Molecular Weight: 114,237 Da
• NCBI Official Full Name: Toll-like receptor 9
• NCBI Official Synonym Full Names: toll-like receptor 9
• NCBI Official Symbol: TLR9
• NCBI Official Synonym Symbols: CD289
• NCBI Protein Information: toll-like receptor 9
• UniProt Protein Name: Toll-like receptor 9
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR9
• UniProt Entry Name: TLR9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

TLR9: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Controls lymphocyte response to Helicobacter infection. Interacts with MYD88 via their respective TIR domains. Interacts (via transmembrane domain) with UNC93B1. Interacts with CD300LH; the interaction may promote full activation of TLR9-triggered innate responses. Interacts with BTK. Interacts with CNPY3 and HSP90B1; this interaction is required for proper folding in the endoplasmic reticulum. Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre- dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver. Belongs to the Toll-like receptor family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; endoplasmic reticulum; basolateral plasma membrane; lysosome; apical plasma membrane; cytoplasm; plasma membrane; integral to membrane; extracellular region; endosome membrane; endosome

Molecular Function: siRNA binding; transmembrane receptor activity; interleukin-1 receptor binding

Biological Process: positive regulation of JNK activity; regulation of cytokine secretion; positive regulation of interleukin-12 production; maintenance of gastrointestinal epithelium; positive regulation of JNK cascade; positive regulation of NF-kappaB import into nucleus; positive regulation of interferon-alpha biosynthetic process; defense response to Gram-negative bacterium; positive regulation of interleukin-18 production; positive regulation of interleukin-10 production; activation of NF-kappaB transcription factor; positive regulation of interleukin-8 production; response to molecule of bacterial origin; negative regulation of interleukin-8 production; positive regulation of interferon-beta production; negative regulation of interleukin-6 production; inflammatory response; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-6 production; positive regulation of tumor necrosis factor production; positive regulation of chemokine production; positive regulation of toll-like receptor signaling pathway; MyD88-dependent toll-like receptor signaling pathway; inhibition of NF-kappaB transcription factor; positive regulation of interferon-beta biosynthetic process; defense response to bacterium; toll-like receptor signaling pathway; negative regulation of toll-like receptor signaling pathway; insulin receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; I-kappaB phosphorylation; positive regulation of interferon-gamma biosynthetic process; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of inflammatory response