Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TLR6 is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human TLR6 Monoclonal Antibody | anti-TLR6 antibody

TLR6 (Toll-like Receptor 6, CD286) (PE)

Gene Names
TLR6; CD286
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TLR6; Monoclonal Antibody; TLR6 (Toll-like Receptor 6; CD286) (PE); anti-TLR6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E4
Specificity
Recognizes human TLR6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
5891
Applicable Applications for anti-TLR6 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from TLR6 (NP_006059) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TLR6 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TLR6 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TLR6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens toll like receptor 6 (TLR6), mRNA
NCBI Official Synonym Full Names
toll like receptor 6
NCBI Official Symbol
TLR6
NCBI Official Synonym Symbols
CD286
NCBI Protein Information
toll-like receptor 6
UniProt Protein Name
Toll-like receptor 6
UniProt Gene Name
TLR6
UniProt Entry Name
TLR6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins. A Ser249Pro polymorphism in the extracellular domain of the encoded protein may be associated with an increased of asthma is some populations.[provided by RefSeq, Jan 2011]

Uniprot Description

TLR6: Participates in the innate immune response to Gram- positive bacteria and fungi. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR2. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: phagocytic vesicle membrane; integral to plasma membrane; plasma membrane

Molecular Function: transmembrane receptor activity; protein heterodimerization activity; receptor activity; diacylated lipoprotein binding

Biological Process: positive regulation of JNK activity; T-helper 1 type immune response; regulation of cytokine secretion; positive regulation of I-kappaB kinase/NF-kappaB cascade; detection of diacylated bacterial lipoprotein; positive regulation of interleukin-6 biosynthetic process; activation of NF-kappaB-inducing kinase; signal transduction; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 6 signaling pathway; defense response to bacterium; toll-like receptor signaling pathway; innate immune response; immune response; inflammatory response; toll-like receptor 4 signaling pathway

Research Articles on TLR6

Similar Products

Product Notes

The TLR6 tlr6 (Catalog #AAA6160737) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TLR6 (Toll-like Receptor 6, CD286) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TLR6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TLR6 tlr6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLR6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.