Mouse anti-Human TLR6 Monoclonal Antibody | anti-TLR6 antibody

TLR6 (Toll-like Receptor 6, CD286) (PE)

Cat. Num. AAA6160737

• Gene Names: TLR6; CD286
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TLR6; Monoclonal Antibody; TLR6 (Toll-like Receptor 6; CD286) (PE); anti-TLR6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E4
• Specificity: Recognizes human TLR6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 5891

• Applicable Applications for anti-TLR6 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa201-300 from TLR6 (NP_006059) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TLR6 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TLR6 antibody

Antibodies; Toll Like Receptors (TLR)

NCBI and Uniprot Product Information

• NCBI GI #: 318067953
• NCBI GeneID: 10333
• NCBI Accession #: NM_006068.4
• NCBI GenBank Nucleotide #: NM_006068
• UniProt Accession #: Q9Y2C9
• NCBI Official Full Name: Homo sapiens toll like receptor 6 (TLR6), mRNA
• NCBI Official Synonym Full Names: toll like receptor 6
• NCBI Official Symbol: TLR6
• NCBI Official Synonym Symbols: CD286
• NCBI Protein Information: toll-like receptor 6
• UniProt Protein Name: Toll-like receptor 6
• UniProt Gene Name: TLR6
• UniProt Entry Name: TLR6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins. A Ser249Pro polymorphism in the extracellular domain of the encoded protein may be associated with an increased of asthma is some populations.[provided by RefSeq, Jan 2011]

Uniprot Description

TLR6: Participates in the innate immune response to Gram- positive bacteria and fungi. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR2. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: phagocytic vesicle membrane; integral to plasma membrane; plasma membrane

Molecular Function: transmembrane receptor activity; protein heterodimerization activity; receptor activity; diacylated lipoprotein binding

Biological Process: positive regulation of JNK activity; T-helper 1 type immune response; regulation of cytokine secretion; positive regulation of I-kappaB kinase/NF-kappaB cascade; detection of diacylated bacterial lipoprotein; positive regulation of interleukin-6 biosynthetic process; activation of NF-kappaB-inducing kinase; signal transduction; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 6 signaling pathway; defense response to bacterium; toll-like receptor signaling pathway; innate immune response; immune response; inflammatory response; toll-like receptor 4 signaling pathway