Mouse TLR2 Monoclonal Antibody | anti-TLR2 antibody

TLR2 (Toll-like Receptor 2, CD282, TIL4) (Biotin)

Cat. Num. AAA6173310

• Gene Names: TLR2; TIL4; CD282
• Applications: Western Blot
• Purity: Purified
• Synonyms: TLR2; Monoclonal Antibody; TLR2 (Toll-like Receptor 2; CD282; TIL4) (Biotin); Toll-like Receptor 2; TIL4; anti-TLR2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G9
• Specificity: Recognizes TLR2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 784

• Applicable Applications for anti-TLR2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TLR2 (AAH33756.1, 201aa-300aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TLR2 expression in transfected 293T cell line by TLR2 monoclonal antibody (M38), clone 2G9.Lane 1: TLR2 transfected lysate (89.8 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TLR2 is 3 ng/ml as a capture antibody.)

Related Product Information for anti-TLR2 antibody

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. [provided by RefSeq]

Product Categories/Family for anti-TLR2 antibody

Antibodies; Toll Like Receptors (TLR)

NCBI and Uniprot Product Information

• NCBI GI #: 21708105
• NCBI GeneID: 7097
• NCBI Official Full Name: TLR2 protein
• NCBI Official Synonym Full Names: toll like receptor 2
• NCBI Official Symbol: TLR2
• NCBI Official Synonym Symbols: TIL4; CD282
• NCBI Protein Information: toll-like receptor 2
• Protein Family: Toll-like receptor

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]