Testing Data
(Detection limit for recombinant GST tagged TIMM8B is 3 ng/ml as a capture antibody.)
Mouse TIMM8B Monoclonal Antibody | anti-TIMM8B antibody
TIMM8B (Translocase of inner Mitochondrial Membrane 8 Homolog B (yeast), DDP2, FLJ21744, MGC102866, MGC117373, TIM8B) (Biotin)
Applications
Western Blot
Purity
Purified
Synonyms
TIMM8B; Monoclonal Antibody; TIMM8B (Translocase of inner Mitochondrial Membrane 8 Homolog B (yeast); DDP2; FLJ21744; MGC102866; MGC117373; TIM8B) (Biotin); Translocase of inner Mitochondrial Membrane 8 Homolog B (yeast); TIM8B; anti-TIMM8B antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G7
Specificity
Recognizes TIMM8B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
83
Applicable Applications for anti-TIMM8B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TIMM8B (NP_036591, 1aa-83aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TIMM8B is 3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TIMM8B is 3 ng/ml as a capture antibody.)
Related Product Information for anti-TIMM8B antibody
This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.
Product Categories/Family for anti-TIMM8B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim8 B
Protein Family
Similar Products
Product Notes
The TIMM8B (Catalog #AAA6172923) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TIMM8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIMM8B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMM8B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
