Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TIMM8A Monoclonal Antibody | anti-TIMM8A antibody

TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A, Deafness Dystonia Protein 1, X-linked Deafness Dystonia Protein, DDP, DDP1, TIM8A) (MaxLight 490)

Gene Names
TIMM8A; DDP; MTS; DDP1; DFN1; TIM8
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TIMM8A; Monoclonal Antibody; TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A; Deafness Dystonia Protein 1; X-linked Deafness Dystonia Protein; DDP; DDP1; TIM8A) (MaxLight 490); anti-TIMM8A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F11
Specificity
Recognizes human TIMM8A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-TIMM8A antibody
FLISA, Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Sandwich FLISA: The detection limit is ~0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa9-97 from human TIMM8A (NP_004076) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-TIMM8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13.4kDa (120aa) confirmed by MALDI-TOF
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim8 A isoform 1
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 8A
NCBI Official Symbol
TIMM8A
NCBI Official Synonym Symbols
DDP; MTS; DDP1; DFN1; TIM8
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim8 A
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim8 A
UniProt Gene Name
TIMM8A
UniProt Synonym Gene Names
DDP; DDP1; TIM8A

NCBI Description

This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2009]

Uniprot Description

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development.

Research Articles on TIMM8A

Similar Products

Product Notes

The TIMM8A timm8a (Catalog #AAA6203743) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A, Deafness Dystonia Protein 1, X-linked Deafness Dystonia Protein, DDP, DDP1, TIM8A) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM8A can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC), Western Blot (WB). Sandwich FLISA: The detection limit is ~0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIMM8A timm8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMM8A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.