Mouse anti-Human TIMM8A Monoclonal Antibody

TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A, Deafness Dystonia Protein 1, X-linked Deafness Dystonia Protein, DDP, DDP1, TIM8A)

Cat. Num. AAA649224

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TIMM8A; Monoclonal Antibody; TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A; Deafness Dystonia Protein 1; X-linked Deafness Dystonia Protein; DDP; DDP1; TIM8A); Anti -TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A; anti-TIMM8A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F11
• Specificity: Recognizes human TIMM8A.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

• Applicable Applications for anti-TIMM8A antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains TIMM8A on human liver
• Immunogen: Partial recombinant corresponding to aa9-97 from human TIMM8A (NP_004076) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD))

Western Blot (WB)

(TIMM8A monoclonal antibody Western Blot analysis of TIMM8A expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody.|Lane 1: TIMM8A transfected lysate (11kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TIMM8A is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-TIMM8A antibody

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane and acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70kD complex mediates the import of much more proteins. It is probably necessary for normal neurologic development.

Product Categories/Family for anti-TIMM8A antibody

Antibodies; Abs to Disease Markers