Mouse anti-Human TIE2 Monoclonal Antibody | anti-TIE2 antibody

TIE2 (Angiopoietin-1 Receptor, Endothelial Tyrosine Kinase, Tunica Interna Endothelial Cell Kinase, Tyrosine Kinase with Ig and EGF Homology Domains-2, Tyrosine-protein Kinase Receptor TEK, Tyrosine-protein Kinase Receptor TIE-2, hTIE2, p140 TEK, CD202b,

Cat. Num. AAA6144808

• Gene Names: TEK; TIE2; VMCM; GLC3E; TIE-2; VMCM1; CD202B
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TIE2; Monoclonal Antibody; TIE2 (Angiopoietin-1 Receptor; Endothelial Tyrosine Kinase; Tunica Interna Endothelial Cell Kinase; Tyrosine Kinase with Ig and EGF Homology Domains-2; Tyrosine-protein Kinase Receptor TEK; Tyrosine-protein Kinase Receptor TIE-2; hTIE2; p140 TEK; CD202b; ; anti-TIE2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F8
• Specificity: Recognizes human TEK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 4500

• Applicable Applications for anti-TIE2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa701-800 from human TEK (AAH35514) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TEK monoclonal antibody, Western Blot analysis of TEK expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged TEK is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-TIE2 antibody

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase.

Product Categories/Family for anti-TIE2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 23273967
• NCBI GeneID: 7010
• UniProt Accession #: Q02763
• NCBI Official Full Name: Homo sapiens TEK tyrosine kinase, endothelial, mRNA
• NCBI Official Synonym Full Names: TEK receptor tyrosine kinase
• NCBI Official Symbol: TEK
• NCBI Official Synonym Symbols: TIE2; VMCM; GLC3E; TIE-2; VMCM1; CD202B
• NCBI Protein Information: angiopoietin-1 receptor
• UniProt Protein Name: Angiopoietin-1 receptor
• Protein Family: Tyrosine-protein kinase receptor
• UniProt Gene Name: TEK
• UniProt Synonym Gene Names: TIE2; VMCM; VMCM1; hTIE2
• UniProt Entry Name: TIE2_HUMAN

NCBI Description

This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fibronectin type III repeats. The ligand angiopoietin-1 binds to this receptor and mediates a signaling pathway that functions in embryonic vascular development. Mutations in this gene are associated with inherited venous malformations of the skin and mucous membranes. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

Uniprot Description

TIE2: a receptor tyrosine kinase of the Tie family. Receptor for angiopoietin 1. Expressed almost exclusively in endothelial cells. May constitute the earliest mammalian endothelial cell lineage marker. Appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase.

Protein type: Membrane protein, integral; EC 2.7.10.1; Kinase, protein; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group; Tie family

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: microvillus; cell surface; focal adhesion; basolateral plasma membrane; integral to plasma membrane; extracellular region; actin filament; intercellular junction; lipid raft; perinuclear region of cytoplasm; apical plasma membrane; plasma membrane; stress fiber; basal plasma membrane

Molecular Function: protein binding; growth factor binding; protein-tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; ATP binding; protein kinase activity

Biological Process: response to peptide hormone stimulus; peptidyl-tyrosine phosphorylation; response to cAMP; cell-matrix adhesion; heart development; protein amino acid autophosphorylation; positive regulation of cytokine secretion during immune response; signal transduction; cell-cell adhesion; cell-cell signaling; positive regulation of focal adhesion formation; angiogenesis; endochondral ossification; Tie receptor signaling pathway; organ regeneration; regulation of establishment and/or maintenance of cell polarity; positive regulation of phosphoinositide 3-kinase activity; positive regulation of peptidyl-serine phosphorylation; protein oligomerization; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; negative regulation of angiogenesis; positive regulation of angiogenesis; positive regulation of protein import into nucleus; response to estrogen stimulus; negative regulation of inflammatory response; endothelial cell proliferation; response to hypoxia; positive regulation of endothelial cell proliferation; regulation of vascular permeability; sprouting angiogenesis; positive regulation of protein amino acid phosphorylation; blood coagulation; leukocyte migration; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Disease: Venous Malformations, Multiple Cutaneous And Mucosal