Mouse TGM2 Monoclonal Antibody | anti-TGM2 antibody

TGM2 (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-glutamyltransferase), G-ALPHA-h, GNAH, TG2, TGC) (AP)

Cat. Num. AAA6164357

• Gene Names: TGM2; TGC; TG(C)
• Applications: Western Blot
• Purity: Purified
• Synonyms: TGM2; Monoclonal Antibody; TGM2 (Transglutaminase 2 (C Polypeptide; Protein-Glutamine-gamma-glutamyltransferase); G-ALPHA-h; GNAH; TG2; TGC) (AP); Transglutaminase 2 (C Polypeptide; TGC; anti-TGM2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A8
• Specificity: Recognizes TGM2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 548

• Applicable Applications for anti-TGM2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TGM2 (AAH03551, 1aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TGM2 monoclonal antibody (M02), clone 1A8. Western Blot analysis of TGM2 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged TGM2 is approximately 0.3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TGM2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TGM2 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-TGM2 antibody

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-TGM2 antibody

Antibodies; Enzymes; Transferase

NCBI and Uniprot Product Information

• NCBI GI #: 13097681
• NCBI GeneID: 7052
• NCBI Official Full Name: Transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
• NCBI Official Synonym Full Names: transglutaminase 2
• NCBI Official Symbol: TGM2
• NCBI Official Synonym Symbols: TGC; TG(C)
• NCBI Protein Information: protein-glutamine gamma-glutamyltransferase 2
• Protein Family: Protein-glutamine gamma-glutamyltransferase

NCBI Description

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]