Testing Data
(Detection limit for recombinant GST tagged TGIF is ~0.1ng/ml as a capture antibody.)
Mouse anti-Human TGIF1 Monoclonal Antibody | anti-TGIF1 antibody
TGIF1 (Homeobox Protein TGIF1, 5'-TG-3'-interacting Factor 1, TGIF, HPE4) (HRP)
Gene Names
TGIF1; HPE4; TGIF
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TGIF1; Monoclonal Antibody; TGIF1 (Homeobox Protein TGIF1; 5'-TG-3'-interacting Factor 1; TGIF; HPE4) (HRP); anti-TGIF1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D12
Specificity
Recognizes human TGIF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
272
Applicable Applications for anti-TGIF1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa163-273 from human TGIF (NP_003235) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TGIF is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TGIF is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-TGIF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
homeobox protein TGIF1 isoform c
NCBI Official Synonym Full Names
TGFB induced factor homeobox 1
NCBI Official Symbol
TGIF1
NCBI Official Synonym Symbols
HPE4; TGIF
NCBI Protein Information
homeobox protein TGIF1
UniProt Protein Name
Homeobox protein TGIF1
Protein Family
UniProt Gene Name
TGIF1
UniProt Synonym Gene Names
TGIF
UniProt Entry Name
TGIF1_HUMAN
NCBI Description
The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2013]
Research Articles on TGIF1
Similar Products
Product Notes
The TGIF1 tgif1 (Catalog #AAA6155397) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TGIF1 (Homeobox Protein TGIF1, 5'-TG-3'-interacting Factor 1, TGIF, HPE4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGIF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TGIF1 tgif1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TGIF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
