Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TFDP1 Monoclonal Antibody | anti-TFDP1 antibody

TFDP1 (Transcription Factor Dp-1, DRTF1-polypeptide 1, DRTF1, E2F Dimerization Partner 1, DP1) (MaxLight 750)

Gene Names
TFDP1; DP1; Dp-1; DRTF1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TFDP1; Monoclonal Antibody; TFDP1 (Transcription Factor Dp-1; DRTF1-polypeptide 1; DRTF1; E2F Dimerization Partner 1; DP1) (MaxLight 750); anti-TFDP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E4
Specificity
Recognizes human TFDP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-TFDP1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa112-221 from human TFDP1 (NP_009042) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TFDP1 antibody
DP family contains at least two members, DP-1 and -2. Structurally, DP-1 and -2 are relatively conserved, yet their expression appears to be tissue specific. E2F-1, a functional target for the tumor suppressor protein Rb, heterodimers with DP-1 and forms an active E2F transcriptional complex. The interaction between members of the E2F and the DP families is mediated, in part, by a leucine repeat which is weakly conserved between the two families.
Product Categories/Family for anti-TFDP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,921 Da
NCBI Official Full Name
transcription factor Dp-1
NCBI Official Synonym Full Names
transcription factor Dp-1
NCBI Official Symbol
TFDP1
NCBI Official Synonym Symbols
DP1; Dp-1; DRTF1
NCBI Protein Information
transcription factor Dp-1; DRTF1-polypeptide 1; E2F dimerization partner 1; E2F-related transcription factor
UniProt Protein Name
Transcription factor Dp-1
Protein Family
UniProt Gene Name
TFDP1
UniProt Synonym Gene Names
DP1; DRTF1
UniProt Entry Name
TFDP1_HUMAN

Uniprot Description

TFDP1: Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F1/DP complex appears to mediate both cell proliferation and apoptosis. Belongs to the E2F/DP family.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: protein domain specific binding; protein binding; DNA binding; transcription coactivator activity; transcription factor activity; transcription factor binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; epidermis development; transcription, DNA-dependent; apoptosis; anoikis; regulation of transcription from RNA polymerase II promoter; cell proliferation; transforming growth factor beta receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; gene expression; mitotic cell cycle; G1/S transition of mitotic cell cycle

Similar Products

Product Notes

The TFDP1 tfdp1 (Catalog #AAA6235741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TFDP1 (Transcription Factor Dp-1, DRTF1-polypeptide 1, DRTF1, E2F Dimerization Partner 1, DP1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFDP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFDP1 tfdp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFDP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.