Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TFAP2A expression in transfected 293T cell line by TFAP2A monoclonal antibody. Lane 1: TFAP2A transfected lysate (48.1kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TFAP2A Monoclonal Antibody | anti-TFAP2A antibody

TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (HRP)

Gene Names
TFAP2A; AP-2; BOFS; AP2TF; TFAP2; AP-2alpha
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TFAP2A; Monoclonal Antibody; TFAP2A (Transcription Factor AP-2-alpha; AP2-alpha; AP-2 Transcription Factor; Activating Enhancer-binding Protein 2-alpha; Activator Protein 2; AP-2; AP2TF; TFAP2; FLJ51761) (HRP); anti-TFAP2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G5
Specificity
Recognizes human TFAP2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TFAP2A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa99-205 from human TFAP2A (AAH17754) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TFAP2A expression in transfected 293T cell line by TFAP2A monoclonal antibody. Lane 1: TFAP2A transfected lysate (48.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TFAP2A expression in transfected 293T cell line by TFAP2A monoclonal antibody. Lane 1: TFAP2A transfected lysate (48.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TFAP2A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TFAP2A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TFAP2A is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TFAP2A is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TFAP2A over-expressed 293 cell line, cotransfected with TFAP2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TFAP2A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TFAP2A over-expressed 293 cell line, cotransfected with TFAP2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TFAP2A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-TFAP2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
47,440 Da
NCBI Official Full Name
Homo sapiens transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha), mRNA
NCBI Official Synonym Full Names
transcription factor AP-2 alpha
NCBI Official Symbol
TFAP2A
NCBI Official Synonym Symbols
AP-2; BOFS; AP2TF; TFAP2; AP-2alpha
NCBI Protein Information
transcription factor AP-2-alpha
Protein Family

NCBI Description

The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009]

Research Articles on TFAP2A

Similar Products

Product Notes

The TFAP2A (Catalog #AAA6155382) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFAP2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFAP2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFAP2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.