Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Tenascin Monoclonal Antibody | anti-TNC antibody

Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 650)

Gene Names
TNC; GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tenascin; Monoclonal Antibody; Tenascin (TN; Tenascin-C; TNC; TN-C; 150-225; Cytotactin; Glioma-associated Extracellular Matrix Antigen; GMEM; GP 150-225; Hexabrachion; HXB; JI; MGC167029; Myotendinous Antigen; Neuronectin) (MaxLight 650); anti-TNC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B4
Specificity
Recognizes human TNC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
2201
Applicable Applications for anti-TNC antibody
FLISA, Western Blot (WB)
Application Notes
Sandwich FLISA: The detection limit is ~10ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa181-290 from human TNC (NP_002151) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-TNC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tenascin
NCBI Official Synonym Full Names
tenascin C
NCBI Official Symbol
TNC
NCBI Official Synonym Symbols
GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225
NCBI Protein Information
tenascin
UniProt Protein Name
Tenascin
Protein Family
UniProt Gene Name
TNC
UniProt Synonym Gene Names
HXB; TN; TN-C
UniProt Entry Name
TENA_HUMAN

NCBI Description

This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. [provided by RefSeq, Jul 2011]

Uniprot Description

TNC: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. Belongs to the tenascin family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9q33

Cellular Component: extracellular matrix; extracellular space; focal adhesion; membrane; extracellular region; basement membrane

Molecular Function: syndecan binding

Biological Process: osteoblast differentiation; extracellular matrix organization and biogenesis; response to ethanol; wound healing; response to mechanical stimulus; positive regulation of cell proliferation; response to wounding; negative regulation of cell adhesion; cell adhesion; axon regeneration in the peripheral nervous system; neuromuscular junction development; odontogenesis of dentine-containing teeth

Disease: Deafness, Autosomal Dominant 56

Research Articles on TNC

Similar Products

Product Notes

The TNC tnc (Catalog #AAA6225052) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tenascin can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Sandwich FLISA: The detection limit is ~10ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNC tnc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tenascin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.