Mouse TEK Monoclonal Antibody | anti-TEK antibody

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 550)

Cat. Num. AAA6219620

• Gene Names: TEK; TIE2; VMCM; GLC3E; TIE-2; VMCM1; CD202B
• Applications: Western Blot
• Purity: Purified
• Synonyms: TEK; Monoclonal Antibody; TEK (TEK Tyrosine Kinase; Endothelial; CD202B; TIE-2; TIE2; VMCM; VMCM1) (MaxLight 550); TEK Tyrosine Kinase; VMCM1; anti-TEK antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6G9
• Specificity: Recognizes TEK.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
• Sequence Length: 1124

• Applicable Applications for anti-TEK antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TEK (AAH35514, 701aa-800aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-TEK antibody

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. [provided by RefSeq]

Product Categories/Family for anti-TEK antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 112180440
• NCBI GeneID: 7010
• NCBI Official Full Name: TEK tyrosine kinase, endothelial
• NCBI Official Synonym Full Names: TEK receptor tyrosine kinase
• NCBI Official Symbol: TEK
• NCBI Official Synonym Symbols: TIE2; VMCM; GLC3E; TIE-2; VMCM1; CD202B
• NCBI Protein Information: angiopoietin-1 receptor
• Protein Family: Tektin

NCBI Description

This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fibronectin type III repeats. The ligand angiopoietin-1 binds to this receptor and mediates a signaling pathway that functions in embryonic vascular development. Mutations in this gene are associated with inherited venous malformations of the skin and mucous membranes. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]