Mouse anti-Human TEAD3 Monoclonal Antibody | anti-TEAD3 antibody

TEAD3 (TEAD5, TEF5, Transcriptional Enhancer Factor TEF-5, DTEF-1, TEA Domain Family Member 3) (FITC)

Cat. Num. AAA6150067

• Gene Names: TEAD3; TEF5; TEAD5; TEF-5; DTEF-1; ETFR-1; TEAD-3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TEAD3; Monoclonal Antibody; TEAD3 (TEAD5; TEF5; Transcriptional Enhancer Factor TEF-5; DTEF-1; TEA Domain Family Member 3) (FITC); anti-TEAD3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C4
• Specificity: Recognizes human TEAD3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-TEAD3 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa215-303 from human TEAD3 (NP_003205) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TEAD3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TEAD3 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TEAD3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 42490753
• NCBI GeneID: 7005
• NCBI Accession #: NP_003205
• NCBI GenBank Nucleotide #: NM_003214
• UniProt Accession #: Q99594
• Molecular Weight: 49kDa
• NCBI Official Full Name: transcriptional enhancer factor TEF-5
• NCBI Official Synonym Full Names: TEA domain transcription factor 3
• NCBI Official Symbol: TEAD3
• NCBI Official Synonym Symbols: TEF5; TEAD5; TEF-5; DTEF-1; ETFR-1; TEAD-3
• NCBI Protein Information: transcriptional enhancer factor TEF-5
• UniProt Protein Name: Transcriptional enhancer factor TEF-5
• Protein Family: Transcriptional enhancer factor
• UniProt Gene Name: TEAD3
• UniProt Synonym Gene Names: TEAD5; TEF5; TEAD-3
• UniProt Entry Name: TEAD3_HUMAN

NCBI Description

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon. [provided by RefSeq, Jul 2008]

Uniprot Description

TEAD3: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds to multiple functional elements of the human chorionic somatomammotropin-B gene enhancer.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p21.2

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; gene expression; positive regulation of transcription from RNA polymerase II promoter; female pregnancy