Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TCN2 is 1ng/ml using MBS632507 as a capture antibody.)

Mouse anti-Human TCN2 Monoclonal Antibody | anti-TCN2 antibody

TCN2 (Transcobalamin 2, TC-2, Transcobalamin II, TC II, TCII, TC2)

Gene Names
TCN2; II; TC; TC2; TC-2; TCII; TC II; D22S676; D22S750
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Purified
Synonyms
TCN2; Monoclonal Antibody; TCN2 (Transcobalamin 2; TC-2; Transcobalamin II; TC II; TCII; TC2); Anti -TCN2 (Transcobalamin 2; anti-TCN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, k
Clone Number
2F4
Specificity
Recognizes human TCN2.
Purity/Purification
Purified
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKSGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANWHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPEGHFGNVYSTPLALQFLMTSPMRGAELGTACLKARVALLASLQDGA
Applicable Applications for anti-TCN2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: ELISA: 1-5ug/ml. Detection limit for sandwich ELISA is ~1ng/ml as a capture antibody.
Western Blot: 1-5ug/ml. Using the immunogen protein lysate a specific band was detected at ~70kD.
Immunogen
TCN2 (AAH11239, 1-401aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TCN2 is 1ng/ml using MBS632507 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TCN2 is 1ng/ml using MBS632507 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using MBS632507 (70.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen using MBS632507 (70.11kD).)
Related Product Information for anti-TCN2 antibody
This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This plasma protein binds cobalamin and mediates the transport of cobalamin into cells. This protein and other mammalian cobalamin-binding proteins, such as transcobalamin I and gastric intrisic factor, may have evolved by duplication of a common ancestral gene.
Product Categories/Family for anti-TCN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,421 Da
NCBI Official Full Name
transcobalamin-2 isoform 2
NCBI Official Synonym Full Names
transcobalamin II
NCBI Official Symbol
TCN2
NCBI Official Synonym Symbols
II; TC; TC2; TC-2; TCII; TC II; D22S676; D22S750
NCBI Protein Information
transcobalamin-2; macrocytic anemia; OTTHUMP00000199117; OTTHUMP00000199118; OTTHUMP00000199119; vitamin B12-binding protein 2; transcobalamin II; macrocytic anemia
UniProt Protein Name
TCN2 protein
Protein Family
UniProt Gene Name
TCN2
UniProt Entry Name
Q96FD4_HUMAN

NCBI Description

This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This plasma protein binds cobalamin and mediates the transport of cobalamin into cells. This protein and other mammalian cobalamin-binding proteins, such as transcobalamin I and gastric intrisic factor, may have evolved by duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants.

Uniprot Description

TCN2: Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells. Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency). This results in various forms of anemia. Belongs to the eukaryotic cobalamin transport proteins family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: lysosomal lumen; extracellular space; extracellular region; endosome

Molecular Function: metal ion binding; cobalamin binding

Biological Process: vitamin metabolic process; cobalamin metabolic process; cobalamin transport; cobalt ion transport; water-soluble vitamin metabolic process

Disease: Transcobalamin Ii Deficiency

Research Articles on TCN2

Similar Products

Product Notes

The TCN2 tcn2 (Catalog #AAA632507) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TCN2 (Transcobalamin 2, TC-2, Transcobalamin II, TC II, TCII, TC2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: ELISA: 1-5ug/ml. Detection limit for sandwich ELISA is ~1ng/ml as a capture antibody. Western Blot: 1-5ug/ml. Using the immunogen protein lysate a specific band was detected at ~70kD. Researchers should empirically determine the suitability of the TCN2 tcn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRHLGAFLFL LGVLGALTEM CEIPEMDSHL VEKSGQHLLP WMDRLSLEHL NPSIYVGLRL SSLQAGTKED LYLHSLKLGY QQCLLGSAFS EDDGDCQGKP SMGQLALYLL ALRANWHDHK GHPHTSYYQY GLGILALCLH QKRVHDSVVD KLLYAVEPFH QGHHSVDTAA MAGLAFTCLK RSNFNPGRRQ RITMAIRTVR EEILKAQTPE GHFGNVYSTP LALQFLMTSP MRGAELGTAC LKARVALLAS LQDGA. It is sometimes possible for the material contained within the vial of "TCN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.