Mouse TBX6 Monoclonal Antibody | anti-TBX6 antibody

TBX6 (T-Box 6, DFNB67) (APC)

Cat. Num. AAA6167851

• Gene Names: TBX6; SCDO5
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: TBX6; Monoclonal Antibody; TBX6 (T-Box 6; DFNB67) (APC); T-Box 6; DFNB67; anti-TBX6 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F11
• Specificity: Recognizes TBX6.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TBX6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TBX6 (NP_004599, 102aa-200aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNS*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TBX6 monoclonal antibody (M16), clone 3F11. Western Blot analysis of TBX6 expression in human pancreas.)

Related Product Information for anti-TBX6 antibody

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. [provided by RefSeq]

Product Categories/Family for anti-TBX6 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 18201900
• NCBI GeneID: 6911
• NCBI Accession #: NP_004599
• NCBI GenBank Nucleotide #: NM_004608
• UniProt Accession #: O95947
• Molecular Weight: 47kDa
• NCBI Official Full Name: T-box transcription factor TBX6
• NCBI Official Synonym Full Names: T-box 6
• NCBI Official Symbol: TBX6
• NCBI Official Synonym Symbols: SCDO5
• NCBI Protein Information: T-box transcription factor TBX6
• UniProt Protein Name: T-box transcription factor TBX6
• Protein Family: T-box transcription factor
• UniProt Gene Name: TBX6
• UniProt Synonym Gene Names: T-box protein 6
• UniProt Entry Name: TBX6_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. [provided by RefSeq, Aug 2008]

Uniprot Description

TBX6: T-box transcription factor that plays an essential role in the determination of the fate of axial stem cells: neural vs mesodermal. Acts in part by down-regulating, a specific enhancer (N1) of SOX2, to inhibit neural development. Seems to play also an essential role in left/right axis determination and acts through effects on Notch signaling around the node as well as through an effect on the morphology and motility of the nodal cilia.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: negative regulation of neuron maturation; anatomical structure morphogenesis; transcription, DNA-dependent; mesoderm formation; positive regulation of transcription from RNA polymerase II promoter; cell fate specification; mesoderm development; negative regulation of transcription from RNA polymerase II promoter; somite rostral/caudal axis specification

Disease: Deafness, Autosomal Recessive 67