Mouse anti-Human TBX22 Monoclonal Antibody | anti-TBX22 antibody

TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (HRP)

Cat. Num. AAA6155345

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TBX22; Monoclonal Antibody; TBX22 (T-box Transcription Factor TBX22; T-box Protein 22; TBOX22) (HRP); anti-TBX22 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A10
• Specificity: Recognizes human TBX22.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TBX22 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa431-520 from human TBX22 (NP_058650) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(Western Blot analysis of TBX22 expression in transfected 293T cell line by TBX22 monoclonal antibody. Lane 1: TBX22 transfected lysate (57.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TBX22 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml].)

Product Categories/Family for anti-TBX22 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 18375603
• NCBI GeneID: 50945
• NCBI Accession #: NP_058650
• NCBI GenBank Nucleotide #: NM_016954
• UniProt Accession #: Q9Y458
• Molecular Weight: 58kDa
• NCBI Official Full Name: T-box transcription factor TBX22 isoform 1
• UniProt Protein Name: T-box transcription factor TBX22
• Protein Family: T-box transcription factor
• UniProt Gene Name: TBX22
• UniProt Synonym Gene Names: TBOX22; T-box protein 22
• UniProt Entry Name: TBX22_HUMAN

Uniprot Description

TBX22: Probable transcriptional regulator involved in developmental processes. This is major determinant crucial to palatogenesis. Defects in TBX22 are the cause of X-linked cleft palate with ankyloglossia (CPX). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Disease: Cleft Palate With Or Without Ankyloglossia, X-linked; Abruzzo-erickson Syndrome