Mouse TAP1 Monoclonal Antibody | anti-TAP1 antibody

TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP), ABC17, ABCB2, APT1, D6S114E, FLJ26666, FLJ41500, PSF1, RING4, TAP1*0102N, TAP1N) (HRP)

Cat. Num. AAA6181923

• Gene Names: TAP1; APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: TAP1; Monoclonal Antibody; TAP1 (Transporter 1; ATP-Binding Cassette; Sub-Family B (MDR/TAP); ABC17; ABCB2; APT1; D6S114E; FLJ26666; FLJ41500; PSF1; RING4; TAP1*0102N; TAP1N) (HRP); Transporter 1; TAP1N; anti-TAP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 3D4
• Specificity: Recognizes TAP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 808

• Applicable Applications for anti-TAP1 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TAP1 (AAH14081, 241aa-350aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE
• Conjugate: HRP
• Preparation and Storage: May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TAP1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TAP1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-TAP1 antibody

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. [provided by RefSeq]

Product Categories/Family for anti-TAP1 antibody

Antibodies; Multi Drug Resistance (MDR)

NCBI and Uniprot Product Information

• NCBI GI #: 15559426
• NCBI GeneID: 6890
• NCBI Official Full Name: Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• NCBI Official Synonym Full Names: transporter 1, ATP binding cassette subfamily B member
• NCBI Official Symbol: TAP1
• NCBI Official Synonym Symbols: APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N
• NCBI Protein Information: antigen peptide transporter 1
• Protein Family: Protein

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]