Western Blot (WB)
(Western Blot detection against Immunogen (48kD).)
Mouse anti-Human TAGLN3 Monoclonal Antibody | anti-tagln3a antibody
TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25)
Gene Names
tagln3a; tagln3; si:ch211-271b14.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TAGLN3; Monoclonal Antibody; TAGLN3 (Transgelin-3; Neuronal Protein NP25; Neuronal Protein 22; NP22; NP25); Anti -TAGLN3 (Transgelin-3; anti-tagln3a antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D2
Specificity
Recognizes human TAGLN3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM*
Applicable Applications for anti-tagln3a antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-200 from human TAGLN3 (AAH15329) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (48kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (48kD).)
Western Blot (WB)
(TAGLN3 monoclonal antibody. Western Blot analysis of TAGLN3 expression in IMR-32.)
Western Blot (WB)
(TAGLN3 monoclonal antibody. Western Blot analysis of TAGLN3 expression in IMR-32.)
Related Product Information for anti-tagln3a antibody
TAGLN3, contains a putative Actin-binding domain, two EF-hand motifs, two potential phosphorylation sites and a calponin-homology (CH) domain. It shares homology with transgelin and calponin, two cytoskeleton-interacting proteins. Belonging to the calponin family, TAGLN3 co-localizes with Actin and tubulin, suggesting a possible role for it in neuronal plasticity or as a signaling protein. Due to a varied expression pattern, it may play different roles in the developing and adult brain.
Product Categories/Family for anti-tagln3a antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The tagln3a (Catalog #AAA6007159) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAGLN3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the tagln3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MANRGPSYGL SREVQEKIEQ KYDADLENKL VDWIILQCAE DIEHPPPGRA HFQKWLMDGT VLCKLINSLY PPGQEPIPKI SESKMAFKQM EQISQFLKAA ETYGVRTTDI FQTVDLWEGK DMAAVQRTLM ALGSVAVTKD DGCYRGEPSW FHRKAQQNRR GFSEEQLRQG QNVIGLQMGS NKGASQAGMT GYGMPRQIM*. It is sometimes possible for the material contained within the vial of "TAGLN3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
