Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TAZ monoclonal antibody. Western Blot analysis of TAZ expression in human kidney.)

Mouse anti-Human, Rat Tafazzin Monoclonal Antibody | anti-TAZ antibody

Tafazzin (TAZ, TAZ Protein, Protein G4.5, FLJ27390, EFE2, G4.5) (AP)

Gene Names
TAZ; EFE; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tafazzin; Monoclonal Antibody; Tafazzin (TAZ; TAZ Protein; Protein G4.5; FLJ27390; EFE2; G4.5) (AP); anti-TAZ antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B10
Specificity
Recognizes human TAZ. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TAZ antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-263 from human TAZ (AAH11515) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TAZ monoclonal antibody. Western Blot analysis of TAZ expression in human kidney.)

Western Blot (WB) (TAZ monoclonal antibody. Western Blot analysis of TAZ expression in human kidney.)

Western Blot (WB)

(TAZ monoclonal antibody. Western Blot analysis of TAZ expression in human uterus myoma.)

Western Blot (WB) (TAZ monoclonal antibody. Western Blot analysis of TAZ expression in human uterus myoma.)

Western Blot (WB)

(TAZ monoclonal antibody. Western Blot analysis of TAZ expression in PC-12.)

Western Blot (WB) (TAZ monoclonal antibody. Western Blot analysis of TAZ expression in PC-12.)

Western Blot (WB)

(TAZ monoclonal antibody, Western Blot analysis of TAZ expression in SW-13.)

Western Blot (WB) (TAZ monoclonal antibody, Western Blot analysis of TAZ expression in SW-13.)

Testing Data

(Detection limit for recombinant GST tagged TAZ is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TAZ is ~3ng/ml as a capture antibody.)
Related Product Information for anti-TAZ antibody
Some isoforms may be involved in cardiolipin (CL) metabolism.
Product Categories/Family for anti-TAZ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,836 Da
NCBI Official Full Name
Homo sapiens tafazzin, mRNA
NCBI Official Synonym Full Names
tafazzin
NCBI Official Symbol
TAZ
NCBI Official Synonym Symbols
EFE; BTHS; EFE2; G4.5; Taz1; CMD3A; LVNCX
NCBI Protein Information
tafazzin
Protein Family

NCBI Description

This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. [provided by RefSeq, Jul 2008]

Research Articles on TAZ

Similar Products

Product Notes

The TAZ (Catalog #AAA6134112) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tafazzin (TAZ, TAZ Protein, Protein G4.5, FLJ27390, EFE2, G4.5) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tafazzin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAZ for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tafazzin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.