Mouse anti-Human TAF4 RNA Polymerase II, TATA Box Binding Protein Monoclonal Antibody | anti-TAF4 antibody

TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-associated Factor, 135kD (TAF4)

Cat. Num. AAA603194

• Gene Names: TAF4; TAF2C; TAF4A; TAF2C1; FLJ41943; TAFII130; TAFII135
• Reactivity: Human
• Applications: Western Blot, Gel Super Shift Assay
• Purity: Affinity Purified; Purified by Protein G affinity chromatography.
• Synonyms: TAF4 RNA Polymerase II; TATA Box Binding Protein; Monoclonal Antibody; TATA Box Binding Protein (TBP)-associated Factor; 135kD (TAF4); Anti -TAF4 RNA Polymerase II; anti-TAF4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1
• Clone Number: 8J146
• Specificity: Recognizes human TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-associated Factor, 135kD.
• Purity/Purification: Affinity Purified; Purified by Protein G affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, 1% BSA and 0.05% sodium azide.

• Applicable Applications for anti-TAF4 antibody: Western Blot (WB), Gel Shift Assay (GS/EMSA)
• Application Notes: Suitable for use in Dot Blot and Western Blot.
• Immunogen: Partial sequence of recombinant full-length protein to human TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-associated Factor corresponding to amino acids within the C-terminal portion of the protein. Immunogen sequence: ETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFT
• Preparation and Storage: May be stored at 4 degree C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile glycerol (40-50%), aliquot and store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Testing Data

Product Categories/Family for anti-TAF4 antibody

Antibodies; Abs to Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 56204143
• NCBI GeneID: 6874
• UniProt Accession #: Q5TBP5; O00268
• Molecular Weight: 97,368 Da
• NCBI Official Full Name: TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
• NCBI Official Synonym Full Names: TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
• NCBI Official Symbol: TAF4
• NCBI Official Synonym Symbols: TAF2C; TAF4A; TAF2C1; FLJ41943; TAFII130; TAFII135
• NCBI Protein Information: transcription initiation factor TFIID subunit 4; TAFII-130; TAFII-135; TAF(II)130; TAF(II)135; OTTHUMP00000031446; OTTHUMP00000031447; TBP-associated factor 4; RNA polymerase II TBP-associated factor subunit C; transcription initiation factor TFIID 135 kD subunit; transcription initiation factor TFIID 130 kDa subunit; transcription initiation factor TFIID 135 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, C1, 130kD; TAF4A RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135 kD
• UniProt Protein Name: TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF4
• UniProt Entry Name: Q5TBP5_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. [provided by RefSeq]

Uniprot Description

TAF4: Makes part of TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Potentiates transcriptional activation by the AF-2S of the retinoic acid, vitamin D3 and thyroid hormone. Belongs to the TAF4 family.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nucleoplasm; transcription factor TFIID complex; cytoplasm

Molecular Function: protein binding; DNA binding; protein heterodimerization activity; transcription coactivator activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; ovarian follicle development; viral reproduction; positive regulation of transcription, DNA-dependent; RNA elongation from RNA polymerase II promoter; transcription initiation; gene expression