<
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Mouse TADA2B Monoclonal Antibody | anti-TADA2B antibody
TADA2B (Transcriptional Adapter 2-beta, ADA2-like Protein beta, ADA2-beta, ADA2B, MGC21874) (FITC)
Gene Names
TADA2B; ADA2B; ADA2(beta)
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TADA2B; Monoclonal Antibody; TADA2B (Transcriptional Adapter 2-beta; ADA2-like Protein beta; ADA2-beta; ADA2B; MGC21874) (FITC); anti-TADA2B antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Specificity
Recognizes human MGC21874. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TADA2B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-111 from MGC21874 (XP_291105) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Western Blot (WB)
(MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in Raw 264.7.)
Western Blot (WB)
(MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in Raw 264.7.)
Western Blot (WB)
(MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in NIH/3T3.)
Western Blot (WB)
(MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in NIH/3T3.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged MGC21874 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MGC21874 is ~0.3ng/ml as a capture antibody.)
Western Blot (WB)
(MGC21874 monoclonal antibody, Western Blot analysis of MGC21874 expression in HeLa.)
Western Blot (WB)
(MGC21874 monoclonal antibody, Western Blot analysis of MGC21874 expression in HeLa.)
Western Blot (WB)
(MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in PC-12.)
Western Blot (WB)
(MGC21874 monoclonal antibody. Western Blot analysis of MGC21874 expression in PC-12.)
Product Categories/Family for anti-TADA2B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Synonym Full Names
transcriptional adaptor 2B
NCBI Official Symbol
TADA2B
NCBI Official Synonym Symbols
ADA2B; ADA2(beta)
NCBI Protein Information
transcriptional adapter 2-beta
Protein Family
NCBI Description
TADA2B functions as a transcriptional adaptor protein that potentiates transcription through coordination of histone acetyltransferase (HAT) activity and by linking activation factors to basal transcriptional machinery (Barlev et al., 2003 [PubMed 12972612]).[supplied by OMIM, Apr 2010]
Research Articles on TADA2B
Similar Products
Product Notes
The TADA2B (Catalog #AAA6148215) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TADA2B (Transcriptional Adapter 2-beta, ADA2-like Protein beta, ADA2-beta, ADA2B, MGC21874) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TADA2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TADA2B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TADA2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
