Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TACR1 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human Tachykinin Receptor 1 Monoclonal Antibody | anti-TACR1 antibody

Tachykinin Receptor 1 (TAC1R, TACR1, NK-1 Receptor, NK1R, NK-1R, NKIR, Substance-P Receptor, SPR) (PE)

Gene Names
TACR1; SPR; NK1R; NKIR; TAC1R
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tachykinin Receptor 1; Monoclonal Antibody; Tachykinin Receptor 1 (TAC1R; TACR1; NK-1 Receptor; NK1R; NK-1R; NKIR; Substance-P Receptor; SPR) (PE); anti-TACR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F7
Specificity
Recognizes human TACR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
407
Applicable Applications for anti-TACR1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa140-244 from human TACR1 (NP_001049) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TACR1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TACR1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-TACR1 antibody
Tachykinin Receptor 1, a member of the Tachykinin Receptor subfamily, is involved in the mediation of phosphatidylinositol metabolism by the tachykinin substance P, also referred to as neurokinin 1. It is associated with the management of depression, anxiety, and stress. It is also involved in regulating behavioral responses, neuronal survival, and cardiovascular and respiratory functions. The tachykinin receptor 1 is implicated in the progression of rheumatoid arthritis and osteoarthritis. Two variants of the tachykinin receptor 1 are produced by alternative splicing. Tachykinin receptor 1 has been reported primarily in brain, and in blood lymphocytes, nose, small intestine, and stomach. ESTs have been isolated from brain and spleen libraries.
Product Categories/Family for anti-TACR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
substance-P receptor isoform long
NCBI Official Synonym Full Names
tachykinin receptor 1
NCBI Official Symbol
TACR1
NCBI Official Synonym Symbols
SPR; NK1R; NKIR; TAC1R
NCBI Protein Information
substance-P receptor
UniProt Protein Name
Substance-P receptor
Protein Family
UniProt Gene Name
TACR1
UniProt Synonym Gene Names
NK1R; TAC1R; SPR; NK-1R
UniProt Entry Name
NK1R_HUMAN

NCBI Description

This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. The encoded protein is also involved in the mediation of phosphatidylinositol metabolism of substance P. [provided by RefSeq, Sep 2008]

Uniprot Description

TACR1: This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: cell surface; integral to plasma membrane; dendrite; cytoplasm; plasma membrane

Molecular Function: protein binding; substance P receptor activity; tachykinin receptor activity

Biological Process: response to nicotine; tachykinin signaling pathway; positive regulation of leukocyte migration; response to morphine; positive regulation of saliva secretion; response to estradiol stimulus; elevation of cytosolic calcium ion concentration; behavioral response to pain; regulation of smooth muscle cell migration; positive regulation of lymphocyte proliferation; positive regulation of stress fiber formation; positive regulation of action potential; response to electrical stimulus; inflammatory response; angiotensin mediated drinking behavior; associative learning; detection of abiotic stimulus; positive regulation of synaptic transmission, cholinergic; regulation of smooth muscle cell proliferation; eating behavior; positive regulation of hormone secretion; positive regulation of synaptic transmission, GABAergic; positive regulation of ossification; positive regulation of vascular permeability; response to ethanol; long-term memory; smooth muscle contraction involved in micturition; response to heat; response to ozone; operant conditioning; positive regulation of vasoconstriction; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); sperm ejaculation; response to progesterone stimulus; positive regulation of epithelial cell proliferation; positive regulation of blood pressure; acute inflammatory response

Research Articles on TACR1

Similar Products

Product Notes

The TACR1 tacr1 (Catalog #AAA6160614) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tachykinin Receptor 1 (TAC1R, TACR1, NK-1 Receptor, NK1R, NK-1R, NKIR, Substance-P Receptor, SPR) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tachykinin Receptor 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TACR1 tacr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tachykinin Receptor 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.