Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human, Rat TAB1 Monoclonal Antibody | anti-TAB1 antibody

TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1, Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1, TGF-beta-activated Kinase 1-binding Protein 1, TAK1-binding Protein 1, MAP3K7IP1) (PE)

Gene Names
TAB1; 3'-Tab1; MAP3K7IP1
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAB1; Monoclonal Antibody; TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1; Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1; TGF-beta-activated Kinase 1-binding Protein 1; TAK1-binding Protein 1; MAP3K7IP1) (PE); anti-TAB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A12
Specificity
Recognizes human MAP3K7IP1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TAB1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_705717) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in HeLa.)

Western Blot (WB) (MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP3K7IP1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAP3K7IP1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAP3K7IP1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAP3K7IP1 is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPA1L and MAP3K7IP1 HeLa cells were stained with HSPA1L rabbit purified polyclonal 1:1200 and MAP3K7IP1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPA1L and MAP3K7IP1 HeLa cells were stained with HSPA1L rabbit purified polyclonal 1:1200 and MAP3K7IP1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in PC-12.)

Western Blot (WB) (MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in PC-12.)
Product Categories/Family for anti-TAB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 isoform beta
NCBI Official Synonym Full Names
TGF-beta activated kinase 1 (MAP3K7) binding protein 1
NCBI Official Symbol
TAB1
NCBI Official Synonym Symbols
3'-Tab1; MAP3K7IP1
NCBI Protein Information
TGF-beta-activated kinase 1 and MAP3K7-binding protein 1

NCBI Description

The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Research Articles on TAB1

Similar Products

Product Notes

The TAB1 (Catalog #AAA6160612) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1, Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1, TGF-beta-activated Kinase 1-binding Protein 1, TAK1-binding Protein 1, MAP3K7IP1) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAB1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.