Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Syntaxin 11 Monoclonal Antibody | anti-STX11 antibody

Syntaxin 11 (Syntaxin-11, STX11, FHL4, HLH4, HPLH4) (MaxLight 650)

Gene Names
STX11; FHL4; HLH4; HPLH4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Syntaxin 11; Monoclonal Antibody; Syntaxin 11 (Syntaxin-11; STX11; FHL4; HLH4; HPLH4) (MaxLight 650); anti-STX11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F9
Specificity
Recognizes human STX11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-STX11 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa11-109 from STX11 (NP_003755) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMK
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-STX11 antibody
MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Product Categories/Family for anti-STX11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.8 kDa (311aa)
NCBI Official Full Name
syntaxin-11
NCBI Official Synonym Full Names
syntaxin 11
NCBI Official Symbol
STX11
NCBI Official Synonym Symbols
FHL4; HLH4; HPLH4
NCBI Protein Information
syntaxin-11
UniProt Protein Name
Syntaxin-11
Protein Family
UniProt Gene Name
STX11
UniProt Entry Name
STX11_HUMAN

NCBI Description

This gene encodes a member of the syntaxin family. Syntaxins have been implicated in the targeting and fusion of intracellular transport vesicles. This family member may regulate protein transport among late endosomes and the trans-Golgi network. Mutations in this gene have been associated with familial hemophagocytic lymphohistiocytosis. [provided by RefSeq, Jul 2008]

Uniprot Description

STX11: SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. Defects in STX11 are the cause of familial hemophagocytic lymphohistiocytosis type 4 (FHL4); also known as HPLH4. Familial hemophagocytic lymphohistiocytosis (FHL) is a genetically heterogeneous, rare autosomal recessive disorder. It is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, hypertriglyceridemia, hypofibrinogenemia, and neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits, and ataxia. Hemophagocytosis is a prominent feature of the disease, and a non-malignant infiltration of macrophages and activated T-lymphocytes in lymph nodes, spleen, and other organs is also found. Belongs to the syntaxin family.

Chromosomal Location of Human Ortholog: 6q24.2

Cellular Component: SNARE complex; Golgi apparatus; synaptic vesicle; plasma membrane; integral to membrane; endomembrane system

Molecular Function: SNAP receptor activity; protein binding; SNARE binding

Biological Process: synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; vesicle docking; natural killer cell degranulation; cytotoxic T cell degranulation; neutrophil degranulation

Disease: Hemophagocytic Lymphohistiocytosis, Familial, 4

Research Articles on STX11

Similar Products

Product Notes

The STX11 stx11 (Catalog #AAA6224938) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Syntaxin 11 (Syntaxin-11, STX11, FHL4, HLH4, HPLH4) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Syntaxin 11 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX11 stx11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Syntaxin 11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.