Mouse anti-Human Synphilin-1 Monoclonal Antibody | anti-Sph1 antibody

Synphilin-1 (Sph1, Alpha-synuclein-interacting Protein, SNCAIP) (HRP)

Cat. Num. AAA6155302

• Gene Names: SNCAIP; Sph1; SYPH1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Synphilin-1; Monoclonal Antibody; Synphilin-1 (Sph1; Alpha-synuclein-interacting Protein; SNCAIP) (HRP); anti-Sph1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A8
• Specificity: Recognizes human SNCAIP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-Sph1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa206-309 from SNCAIP (NP_005451) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Testing Data

(Detection limit for recombinant GST tagged SNCAIP is ~0.03ng/ml as a capture antibody)

Related Product Information for anti-Sph1 antibody

Parkinson is the second most common neurodegenerative disease after Alzheimers. About 1 percent of people over the age of 65 and 3 percent of people over the age of 75 are affected by the disease. The mutation is the most common cause of Parkinson disease identified to date. Synuclein alpha interacting protein (Synphilin-1) contains several protein-protein interaction domains and interacts with alpha synuclein in neurons. Mutations of SNCAIP have been linked to Parkinson disease. The amino acid sequence of synphilin-1 shows extensive homology with its human counterpart, especially in regions containing ankyrin-like motifs and the coiled-coil domain. Expression of mouse synphilin-1 in tissues is similar to its human counterpart. Synphilin-1 has an important role in the formation of aggregates and cytotoxicity in Parkinson disease and that Dorfin may be involved in the pathogenic process by ubiquitylation of synphilin-1. Role of synphilin-1 in synaptic function and protein degradation and in the molecular mechanisms leading to neurodegeneration in Parkinson disease.

Product Categories/Family for anti-Sph1 antibody

Antibodies; Synuclein

NCBI and Uniprot Product Information

• NCBI GI #: 76563940
• NCBI GeneID: 9627
• NCBI Accession #: NP_005451
• NCBI GenBank Nucleotide #: NM_005460
• UniProt Accession #: Q9Y6H5; Q05BS1; Q1PSC2; Q49AC6; Q504U9; Q6L984; Q6L985; Q6L986; Q9HC59; D3DSZ1
• Molecular Weight: 64,469 Da
• NCBI Official Full Name: synphilin-1 isoform 1
• NCBI Official Synonym Full Names: synuclein alpha interacting protein
• NCBI Official Symbol: SNCAIP
• NCBI Official Synonym Symbols: Sph1; SYPH1
• NCBI Protein Information: synphilin-1
• UniProt Protein Name: Synphilin-1
• Protein Family: Synphilin
• UniProt Gene Name: SNCAIP
• UniProt Synonym Gene Names: Sph1
• UniProt Entry Name: SNCAP_HUMAN

NCBI Description

This gene encodes a protein containing several protein-protein interaction domains, including ankyrin-like repeats, a coiled-coil domain, and an ATP/GTP-binding motif. The encoded protein interacts with alpha-synuclein in neuronal tissue and may play a role in the formation of cytoplasmic inclusions and neurodegeneration. A mutation in this gene has been associated with Parkinson's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

SNCAIP: Isoform 2 inhibits the ubiquitin ligase activity of SIAH1 and inhibits proteasomal degradation of target proteins. Isoform 2 inhibits autoubiquitination and proteasomal degradation of SIAH1, and thereby increases cellular levels of SIAH. Isoform 2 modulates SNCA monoubiquitination by SIAH1. Defects in SNCAIP may be a cause of Parkinson disease (PARK). A complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability. Additional features are characteristic postural abnormalities, dysautonomia, dystonic cramps, and dementia. The pathology of Parkinson disease involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. The disease is progressive and usually manifests after the age of 50 years, although early-onset cases (before 50 years) are known. The majority of the cases are sporadic suggesting a multifactorial etiology based on environmental and genetic factors. However, some patients present with a positive family history for the disease. Familial forms of the disease usually begin at earlier ages and are associated with atypical clinical features. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: presynaptic membrane; synaptic vesicle; cell soma; cytoplasm

Molecular Function: identical protein binding; protein binding; ubiquitin protein ligase binding

Biological Process: regulation of neurotransmitter secretion; dopamine metabolic process

Disease: Parkinson Disease, Late-onset