Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SYNJ1 Monoclonal Antibody | anti-SYNJ1 antibody

SYNJ1 (Synaptojanin-1, Synaptic Inositol 1,4,5-trisphosphate 5-phosphatase 1, INPP5G, KIAA0910)

Gene Names
SYNJ1; INPP5G
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SYNJ1; Monoclonal Antibody; SYNJ1 (Synaptojanin-1; Synaptic Inositol 1; 4; 5-trisphosphate 5-phosphatase 1; INPP5G; KIAA0910); Anti -SYNJ1 (Synaptojanin-1; anti-SYNJ1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A2
Specificity
Recognizes human SYNJ1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER
Applicable Applications for anti-SYNJ1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1474-1574 from SYNJ1 (NP_003886) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SYNJ1 monoclonal antibody Western Blot analysis of SYNJ1 expression in Hela NE.)

Western Blot (WB) (SYNJ1 monoclonal antibody Western Blot analysis of SYNJ1 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged SYNJ1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SYNJ1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SYNJ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
173,103 Da
NCBI Official Full Name
synaptojanin-1 isoform a
NCBI Official Synonym Full Names
synaptojanin 1
NCBI Official Symbol
SYNJ1
NCBI Official Synonym Symbols
INPP5G
NCBI Protein Information
synaptojanin-1; inositol 5'-phosphatase (synaptojanin 1); synaptojanin-1, polyphosphoinositide phosphatase; synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1; synaptic inositol-1,4,5-trisphosphate 5-phosphatase 1
UniProt Protein Name
Synaptojanin-1
Protein Family
UniProt Gene Name
SYNJ1
UniProt Synonym Gene Names
KIAA0910
UniProt Entry Name
SYNJ1_HUMAN

NCBI Description

This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

Function: Inositol 5-phosphatase which has a role in clathrin-mediated endocytosis.

Catalytic activity: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 4-phosphate + phosphate.

Subunit structure: Interacts with ASH/GRB2. Interacts with PACSIN1, PACSIN2 and PACSIN3

By similarity. Binds AMPH, SH3GL1, SH3GL2 and SH3GL3. Interacts with MYO1E (via SH3 domain). Ref.6 Ref.7

Subcellular location: Cytoplasm

By similarity.

Tissue specificity: Concentrated at clathrin-coated endocytic intermediates in nerve terminals. Isoform 1 is more enriched than isoform 2 in developing brain as well as non-neuronal cells. Isoform 2 is very abundant in nerve terminals.

Domain: Binds to EPS15 (a clathrin coat-associated protein) via a C-terminal domain containing three Asn-Pro-Phe (NPF) repeats

By similarity.The C-terminal proline-rich region mediates binding to a variety of SH3 domain-containing proteins including AMPH, SH3GL1, SH3GL2, SH3GL3 and GRB2.

Sequence similarities: Belongs to the synaptojanin family.In the central section; belongs to the inositol 1,4,5-trisphosphate 5-phosphatase family.Contains 1 RRM (RNA recognition motif) domain.Contains 1 SAC domain.

Sequence caution: The sequence BAA74933.2 differs from that shown. Reason: Erroneous initiation.

Research Articles on SYNJ1

Similar Products

Product Notes

The SYNJ1 synj1 (Catalog #AAA649874) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SYNJ1 (Synaptojanin-1, Synaptic Inositol 1,4,5-trisphosphate 5-phosphatase 1, INPP5G, KIAA0910) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYNJ1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SYNJ1 synj1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KISNPKGWVT FEEEEDFGVK GKSKSACSDL LGNQPSSFSG SNLTLNDDWN KGTNVSFCVL PSRRPPPPPV PLLPPGTSPP VDPFTTLASK ASPTLDFTER. It is sometimes possible for the material contained within the vial of "SYNJ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.