Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SYNE2 Monoclonal Antibody | anti-SYNE2 antibody

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (MaxLight 750)

Gene Names
SYNE2; NUA; EDMD5; KASH2; Nesp2; TROPH; NUANCE; SYNE-2; Nesprin-2
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SYNE2; Monoclonal Antibody; SYNE2 (Synaptic Nuclear Envelope Protein 2; Syne-2; Nesprin-2; Nesp2; Nuclear Envelope Spectrin Repeat Protein 2; Nucleus and Actin Connecting Element Protein; Protein NUANCE; NUA; EDMD5; KIAA1011; TROPH) (MaxLight 750); anti-SYNE2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5E5
Specificity
Recognizes human SYNE2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
21772
Applicable Applications for anti-SYNE2 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa6702-6799 from SYNE2 (NP_055995) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SYNE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens spectrin repeat containing nuclear envelope protein 2 (SYNE2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
spectrin repeat containing nuclear envelope protein 2
NCBI Official Symbol
SYNE2
NCBI Official Synonym Symbols
NUA; EDMD5; KASH2; Nesp2; TROPH; NUANCE; SYNE-2; Nesprin-2
NCBI Protein Information
nesprin-2
UniProt Protein Name
Nesprin-2
Protein Family
UniProt Gene Name
SYNE2
UniProt Synonym Gene Names
KIAA1011; NUA; Protein NUANCE; Syne-2
UniProt Entry Name
SYNE2_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

SYNE2: a nuclear transmembrane protein involved in the maintenance of nuclear organization and structural integrity. The largest part of the protein is cytoplasmic, while its C-terminal part is associated with the nuclear envelope, most probably the outer nuclear membrane. Remains associated with the nuclear envelope during its breakdown in mitotic cells. Probable anchoring protein which theters the nucleus to the cytoskeleton. Connects nuclei to the cytoskeleton by interacting with the nuclear envelope and with F-actin in the cytoplasm. Nine alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.2

Cellular Component: nuclear outer membrane; filopodium membrane; intermediate filament cytoskeleton; sarcoplasmic reticulum membrane; nuclear membrane; focal adhesion; nuclear lumen; mitochondrion; sarcoplasmic reticulum; integral to membrane; nuclear envelope; Z disc; nucleoplasm; cytoplasm; nucleus

Molecular Function: actin filament binding; protein binding; actin binding

Biological Process: centrosome localization; establishment and/or maintenance of cell polarity; nuclear migration along microfilament; nuclear migration; nuclear membrane organization and biogenesis; positive regulation of cell migration

Disease: Emery-dreifuss Muscular Dystrophy 5, Autosomal Dominant

Research Articles on SYNE2

Similar Products

Product Notes

The SYNE2 syne2 (Catalog #AAA6235651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYNE2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SYNE2 syne2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SYNE2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.