Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Synapsin I Monoclonal Antibody | anti-SYN-I antibody

Synapsin I (Synapsin 1, Synapsin-1, SYN1, SYN-1, Synapsin-I, SYNI, SYN-I, Brain Protein 4.1) (MaxLight 490)

Gene Names
SYN1; SYNI; MRX50; SYN1a; SYN1b
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Synapsin I; Monoclonal Antibody; Synapsin I (Synapsin 1; Synapsin-1; SYN1; SYN-1; Synapsin-I; SYNI; SYN-I; Brain Protein 4.1) (MaxLight 490); anti-SYN-I antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F6
Specificity
Recognizes human SYN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
705
Applicable Applications for anti-SYN-I antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa362-451 from human SYN1 (NP_008881) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SYN-I antibody
Synapsins are abundant brain proteins essential for regulating neurotransmitter release. All synapsins contain a short N-terminal domain that is highly conserved and phosphorylated by PKA or CaM kinase I. Phosphorylation of synapsin N-terminal domain at Ser9 inhibits its binding to phospholipids and diassociates synapsins from synaptic vesicles.
Product Categories/Family for anti-SYN-I antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
synapsin-1 isoform Ia
NCBI Official Synonym Full Names
synapsin I
NCBI Official Symbol
SYN1
NCBI Official Synonym Symbols
SYNI; MRX50; SYN1a; SYN1b
NCBI Protein Information
synapsin-1
UniProt Protein Name
Synapsin-1
UniProt Gene Name
SYN1
UniProt Entry Name
SYN1_HUMAN

NCBI Description

This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

SYN1: neuronal phosphoprotein which associates with the cytoplasmic surface of synaptic vesicles and binds to the cytoskeleton. May function in the regulation of neurotransmitter release and of axonogenesis and synaptogenesis. Mutations may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Two differentially spiced isoforms have been reported.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: Golgi apparatus; synaptic vesicle; dendrite; cytosol; cell junction

Molecular Function: protein binding; transporter activity; actin binding; protein kinase binding; calcium-dependent protein binding; catalytic activity; ATP binding

Biological Process: synaptic transmission; metabolic process; neurotransmitter secretion; regulation of neurotransmitter secretion

Disease: Epilepsy, X-linked, With Variable Learning Disabilities And Behavior Disorders

Research Articles on SYN-I

Similar Products

Product Notes

The SYN-I syn1 (Catalog #AAA6203623) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Synapsin I (Synapsin 1, Synapsin-1, SYN1, SYN-1, Synapsin-I, SYNI, SYN-I, Brain Protein 4.1) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Synapsin I can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SYN-I syn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Synapsin I, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.