Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SWAP70 on HeLa cell. [antibody concentration 10 ug/ml])
Mouse SWAP70 Monoclonal Antibody | anti-SWAP70 antibody
SWAP70 (SWAP-70 Protein, FLJ39540, HSPC321, KIAA0640, SWAP-70) (APC)
Gene Names
SWAP70; HSPC321; SWAP-70
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SWAP70; Monoclonal Antibody; SWAP70 (SWAP-70 Protein; FLJ39540; HSPC321; KIAA0640; SWAP-70) (APC); SWAP-70 Protein; SWAP-70; anti-SWAP70 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A12
Specificity
Recognizes SWAP70.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SWAP70 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SWAP70 (NP_055870, 378aa-451aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SWAP70 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SWAP70 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SWAP70 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SWAP70 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-SWAP70 antibody
Mouse monoclonal antibody raised against a partial recombinant SWAP70.
Product Categories/Family for anti-SWAP70 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68,998 Da
NCBI Official Full Name
switch-associated protein 70 isoform 1
NCBI Official Synonym Full Names
SWAP switching B-cell complex 70kDa subunit
NCBI Official Symbol
SWAP70
NCBI Official Synonym Symbols
HSPC321; SWAP-70
NCBI Protein Information
switch-associated protein 70
UniProt Protein Name
Switch-associated protein 70
Protein Family
UniProt Gene Name
SWAP70
UniProt Synonym Gene Names
KIAA0640; SWAP-70
UniProt Entry Name
SWP70_HUMAN
Uniprot Description
SWAP-70: Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. It also mediates signaling of membrane ruffling. Regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.
Protein type: GEFs; GEFs, Rac/Rho
Chromosomal Location of Human Ortholog: 11p15
Cellular Component: lamellipodium; cytoplasm; plasma membrane; nucleus
Molecular Function: DNA binding; calcium ion binding; ATP binding
Biological Process: isotype switching
Similar Products
Product Notes
The SWAP70 swap70 (Catalog #AAA6169422) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SWAP70 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SWAP70 swap70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SWAP70, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
