Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SUMO4 expression in transfected 293T cell line by SUMO4 monoclonal antibody (M02), clone 1D3.Lane 1: SUMO4 transfected lysate (Predicted MW: 10.7 KDa).Lane 2: Non-transfected lysate.)

Mouse SUMO4 Monoclonal Antibody | anti-SUMO4 antibody

SUMO4 (SMT3 Suppressor of mif two 3 Homolog 4 (S. cerevisiae), IDDM5, SMT3H4, SUMO-4, dJ281H8.4) (APC)

Gene Names
SUMO4; IDDM5; SMT3H4; SUMO-4; dJ281H8.4
Applications
Western Blot
Purity
Purified
Synonyms
SUMO4; Monoclonal Antibody; SUMO4 (SMT3 Suppressor of mif two 3 Homolog 4 (S. cerevisiae); IDDM5; SMT3H4; SUMO-4; dJ281H8.4) (APC); SMT3 Suppressor of mif two 3 Homolog 4 (S. cerevisiae); dJ281H8.4; anti-SUMO4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D3
Specificity
Recognizes SUMO4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SUMO4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SUMO4 (NP_001002255.1, 1aa-95aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SUMO4 expression in transfected 293T cell line by SUMO4 monoclonal antibody (M02), clone 1D3.Lane 1: SUMO4 transfected lysate (Predicted MW: 10.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SUMO4 expression in transfected 293T cell line by SUMO4 monoclonal antibody (M02), clone 1D3.Lane 1: SUMO4 transfected lysate (Predicted MW: 10.7 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SUMO4 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SUMO4 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-SUMO4 antibody
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq]
Product Categories/Family for anti-SUMO4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,685 Da
NCBI Official Full Name
small ubiquitin-related modifier 4
NCBI Official Synonym Full Names
SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
NCBI Official Symbol
SUMO4
NCBI Official Synonym Symbols
IDDM5; SMT3H4; SUMO-4; dJ281H8.4
NCBI Protein Information
small ubiquitin-related modifier 4; OTTHUMP00000017390; SMT3 suppressor of mif two 3 homolog 2; small ubiquitin-like modifier 4 protein
UniProt Protein Name
Small ubiquitin-related modifier 4
UniProt Gene Name
SUMO4
UniProt Synonym Gene Names
SMT3H4; SUMO-4
UniProt Entry Name
SUMO4_HUMAN

NCBI Description

This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq]

Uniprot Description

SUMO4: Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I. Belongs to the ubiquitin family. SUMO subfamily.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 6q25

Cellular Component: nucleus

Biological Process: protein sumoylation

Disease: Diabetes Mellitus, Insulin-dependent, 5

Research Articles on SUMO4

Similar Products

Product Notes

The SUMO4 sumo4 (Catalog #AAA6169879) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SUMO4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUMO4 sumo4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUMO4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.