Testing Data
(Detection limit for recombinant GST tagged SUMO2 is 0.1 ng/ml as a capture antibody.)
Mouse SUMO2 Monoclonal Antibody | anti-SUMO2 antibody
SUMO2 (SMT3 Suppressor of mif two 3 Homolog 2 (S. cerevisiae), HSMT3, MGC117191, SMT3B, SMT3H2) (HRP)
Gene Names
SUMO2; HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2
Applications
Western Blot
Purity
Purified
Synonyms
SUMO2; Monoclonal Antibody; SUMO2 (SMT3 Suppressor of mif two 3 Homolog 2 (S. cerevisiae); HSMT3; MGC117191; SMT3B; SMT3H2) (HRP); SMT3 Suppressor of mif two 3 Homolog 2 (S. cerevisiae); SMT3H2; anti-SUMO2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C7-1A11
Specificity
Recognizes SUMO2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
95
Applicable Applications for anti-SUMO2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SUMO2 (AAH08450, 1aa-95aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SUMO2 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SUMO2 is 0.1 ng/ml as a capture antibody.)
Product Categories/Family for anti-SUMO2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
NCBI Official Synonym Full Names
small ubiquitin like modifier 2
NCBI Official Symbol
SUMO2
NCBI Official Synonym Symbols
HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2
NCBI Protein Information
small ubiquitin-related modifier 2
Protein Family
NCBI Description
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Research Articles on SUMO2
Similar Products
Product Notes
The SUMO2 (Catalog #AAA6182119) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SUMO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUMO2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUMO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
