Mouse anti-Human, Mouse STXBP1 Monoclonal Antibody | anti-STXBP1 antibody

STXBP1 (Syntaxin-binding Protein 1, Protein Unc-18 Homolog, Unc-18-1, Protein Unc-18 Homolog A, Unc-18A, N-Sec1, p67, UNC18A) (HRP)

Cat. Num. AAA6155269

• Gene Names: STXBP1; P67; NSEC1; UNC18; N-Sec1; RBSEC1; unc-18A; unc18-1; MUNC18-1
• Reactivity: Human, Mouse
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STXBP1; Monoclonal Antibody; STXBP1 (Syntaxin-binding Protein 1; Protein Unc-18 Homolog; Unc-18-1; Protein Unc-18 Homolog A; Unc-18A; N-Sec1; p67; UNC18A) (HRP); anti-STXBP1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D1
• Specificity: Recognizes human STXBP1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 603

• Applicable Applications for anti-STXBP1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa74-169 from human STXBP1 (NP_003156) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STXBP1 monoclonal antibody, Western Blot analysis of STXBP1 expression in HeLa.)

Western Blot (WB)

(STXBP1 monoclonal antibody. Western Blot analysis of STXBP1 expression in Raw 264.7.)

Western Blot (WB)

(STXBP1 monoclonal antibody. Western Blot analysis of STXBP1 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STXBP1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-STXBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4507297
• NCBI GeneID: 6812
• NCBI Accession #: NP_003156
• NCBI GenBank Nucleotide #: NM_003165
• UniProt Accession #: P61764
• NCBI Official Full Name: syntaxin-binding protein 1 isoform a
• NCBI Official Synonym Full Names: syntaxin binding protein 1
• NCBI Official Symbol: STXBP1
• NCBI Official Synonym Symbols: P67; NSEC1; UNC18; N-Sec1; RBSEC1; unc-18A; unc18-1; MUNC18-1
• NCBI Protein Information: syntaxin-binding protein 1
• UniProt Protein Name: Syntaxin-binding protein 1
• Protein Family: Syntaxin-binding protein
• UniProt Gene Name: STXBP1
• UniProt Synonym Gene Names: UNC18A; Unc18-1; Unc-18A
• UniProt Entry Name: STXB1_HUMAN

NCBI Description

This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]

Uniprot Description

STXBP1: may participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions. Two splice-variant isoforms have been described.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: nucleoplasm; protein complex; mitochondrion; cytoplasm; plasma membrane; cytosol

Molecular Function: identical protein binding; protein domain specific binding; SNARE binding; syntaxin binding; syntaxin-1 binding; protein N-terminus binding; protein kinase binding

Biological Process: protein stabilization; synaptic vesicle maturation; neurotransmitter secretion; regulation of synaptic vesicle fusion to presynaptic membrane; positive regulation of calcium ion-dependent exocytosis; synaptic transmission; protein transport; platelet degranulation; axon target recognition; glutamate secretion; energy reserve metabolic process; neuromuscular synaptic transmission; negative regulation of neuron apoptosis; negative regulation of synaptic transmission, GABAergic; regulation of insulin secretion; vesicle docking during exocytosis

Disease: Epileptic Encephalopathy, Early Infantile, 4