Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Mouse anti-Human STRADA Monoclonal Antibody | anti-STRADA antibody

STRADA (LYK5, STE20-related Kinase Adapter Protein alpha, STRAD alpha, STE20-related Adapter Protein, Serologically Defined Breast Cancer Antigen NY-BR-96, STRAD, FLJ90524)

Gene Names
STRADA; LYK5; PMSE; Stlk; STRAD; NY-BR-96
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
STRADA; Monoclonal Antibody; STRADA (LYK5; STE20-related Kinase Adapter Protein alpha; STRAD alpha; STE20-related Adapter Protein; Serologically Defined Breast Cancer Antigen NY-BR-96; STRAD; FLJ90524); Anti -STRADA (LYK5; anti-STRADA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E4
Specificity
Recognizes human LYK5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCS
Applicable Applications for anti-STRADA antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml
Immunogen
Partial recombinant corresponding to aa251-347 from human LYK5 (NP_699166) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB)

(LYK5 monoclonal antibody. Western Blot analysis of LYK5 expression in Hela NE.)

Western Blot (WB) (LYK5 monoclonal antibody. Western Blot analysis of LYK5 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STRADA on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 6ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STRADA on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 6ug/ml].)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between STK11 and STRADA HeLa cells were stained with STK11 rabbit purified polyclonal 1:1200 and STRADA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between STK11 and STRADA HeLa cells were stained with STK11 rabbit purified polyclonal 1:1200 and STRADA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-STRADA antibody
Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation.
Product Categories/Family for anti-STRADA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,369 Da
NCBI Official Full Name
STRADA protein
NCBI Official Synonym Full Names
STE20-related kinase adaptor alpha
NCBI Official Symbol
STRADA
NCBI Official Synonym Symbols
LYK5; PMSE; Stlk; STRAD; NY-BR-96
NCBI Protein Information
STE20-related kinase adapter protein alpha; STRAD alpha; protein kinase LYK5; STE20-like pseudokinase; serologically defined breast cancer antigen NY-BR-96
UniProt Protein Name
STE20-related kinase adapter protein alpha
UniProt Gene Name
STRADA
UniProt Synonym Gene Names
LYK5; STRAD; STRAD alpha
UniProt Entry Name
STRAA_HUMAN

NCBI Description

The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. [provided by RefSeq, Sep 2009]

Uniprot Description

STRAD: a pseudokinase which, in complex with CAB39, binds to and activates LKB1. Relocates LKB1 from the nucleus to the cytoplasm. Plays an essential role in LKB1-mediated G1 cell cycle arrest. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; Protein kinase, STE; Kinase, protein; STE group; STE20 family; STLK subfamily

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activator activity; protein binding; kinase binding; protein kinase activator activity; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: activation of protein kinase activity; insulin receptor signaling pathway; protein export from nucleus; mitotic cell cycle; cell cycle arrest; protein amino acid phosphorylation

Disease: Polyhydramnios, Megalencephaly, And Symptomatic Epilepsy

Research Articles on STRADA

Similar Products

Product Notes

The STRADA strada (Catalog #AAA643791) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STRADA (LYK5, STE20-related Kinase Adapter Protein alpha, STRAD alpha, STE20-related Adapter Protein, Serologically Defined Breast Cancer Antigen NY-BR-96, STRAD, FLJ90524) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STRADA can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml. Researchers should empirically determine the suitability of the STRADA strada for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLEKLNGTVP CLLDTSTIPA EELTMSPSRS VANSGLSDSL TTSTPRPSNG DSPSHPYHRT FSPHFHHFVE QCLQRNPDAR YPCWPGPGLR ESRGCS. It is sometimes possible for the material contained within the vial of "STRADA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.