Mouse anti-Human STK17A Monoclonal Antibody | anti-STK17A antibody

STK17A (Serine/threonine-protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, DRAK1) (HRP)

Cat. Num. AAA6155241

• Gene Names: STK17A; DRAK1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STK17A; Monoclonal Antibody; STK17A (Serine/threonine-protein Kinase 17A; DAP Kinase-related Apoptosis-inducing Protein Kinase 1; DRAK1) (HRP); EC=2.7.11.1; anti-STK17A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D12
• Specificity: Recognizes human STK17A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1766

• Applicable Applications for anti-STK17A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.2ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-414 from STK17A (AAH47696) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFI*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STK17A monoclonal antibody Western Blot analysis of STK17A expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of STK17A expression in transfected 293T cell line by STK17A monoclonal antibody Lane 1: STK17A transfected lysate (46.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STK17A on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 1.2ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STK17A is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of STK17A over-expressed 293 cell line, cotransfected with STK17A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with STK17A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-STK17A antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 28839697
• NCBI GeneID: 9263
• NCBI Official Full Name: Homo sapiens serine/threonine kinase 17a, mRNA
• NCBI Official Synonym Full Names: serine/threonine kinase 17a
• NCBI Official Symbol: STK17A
• NCBI Official Synonym Symbols: DRAK1
• NCBI Protein Information: serine/threonine-protein kinase 17A
• Protein Family: Serine/threonine-protein kinase

NCBI Description

This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity. [provided by RefSeq, Jul 2008]