Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.)

Mouse STIP1 Monoclonal Antibody | anti-STIP1 antibody

STIP1 (Stress-Induced-Phosphoprotein 1, HOP, IEF-SSP-3521, P60, STI1, STI1L) (AP)

Gene Names
STIP1; HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
STIP1; Monoclonal Antibody; STIP1 (Stress-Induced-Phosphoprotein 1; HOP; IEF-SSP-3521; P60; STI1; STI1L) (AP); Stress-Induced-Phosphoprotein 1; STI1L; anti-STIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C6
Specificity
Recognizes STIP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STIP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.)

Western Blot (WB) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.)

Western Blot (WB)

(STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.)

Western Blot (WB) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.)

Western Blot (WB)

(STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.)

Western Blot (WB) (STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-STIP1 antibody
Mouse monoclonal antibody raised against a partial recombinant STIP1.
Product Categories/Family for anti-STIP1 antibody
References
1. Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells. Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH.Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,639 Da
NCBI Official Full Name
stress-induced-phosphoprotein 1 isoform b
NCBI Official Synonym Full Names
stress-induced phosphoprotein 1
NCBI Official Symbol
STIP1
NCBI Official Synonym Symbols
HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
NCBI Protein Information
stress-induced-phosphoprotein 1; NY-REN-11 antigen; Hsp70/Hsp90-organizing protein; hsc70/Hsp90-organizing protein; renal carcinoma antigen NY-REN-11; transformation-sensitive protein IEF SSP 3521; epididymis secretory sperm binding protein Li 94n
UniProt Protein Name
Stress-induced-phosphoprotein 1
UniProt Gene Name
STIP1
UniProt Synonym Gene Names
STI1; Hop
UniProt Entry Name
STIP1_HUMAN

NCBI Description

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009]

Uniprot Description

STI1: a protein that is apparently involved in the response to stress. Specifically interacts with the C-terminal tails of Hsp70 and Hsp90 via TPR1 and TPR2A domains. Deletion of STI1 reduces the activity of the glucocorticoid receptor, a Hsp90 target protein. Phosphorylated in vitro by p90RSK and casein kinase II.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi apparatus; nucleus

Molecular Function: protein binding

Biological Process: response to stress

Research Articles on STIP1

Similar Products

Product Notes

The STIP1 stip1 (Catalog #AAA6165422) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STIP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STIP1 stip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.