Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STAT5A monoclonal antibody, Western Blot analysis of STAT5A expression in k-562.)

Mouse anti-Human STAT5A Monoclonal Antibody | anti-STAT5A antibody

STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (FITC)

Gene Names
STAT5A; MGF; STAT5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STAT5A; Monoclonal Antibody; STAT5A (Signal Transducer and Activator of Transcription 5A; STAT5) (FITC); anti-STAT5A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B12
Specificity
Recognizes human STAT5A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-STAT5A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-104 from human STAT5A (AAH27036) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STAT5A monoclonal antibody, Western Blot analysis of STAT5A expression in k-562.)

Western Blot (WB) (STAT5A monoclonal antibody, Western Blot analysis of STAT5A expression in k-562.)

Western Blot (WB)

(Western Blot analysis of STAT5A expression in transfected 293T cell line by STAT5A monoclonal antibody. Lane 1: STAT5A transfected lysate (Predicted MW: 90.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STAT5A expression in transfected 293T cell line by STAT5A monoclonal antibody. Lane 1: STAT5A transfected lysate (Predicted MW: 90.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged STAT5A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STAT5A is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between STAT1 and STAT5A HeLa cells were stained with STAT1 rabbit purified polyclonal 1:1200 and STAT5A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between STAT1 and STAT5A HeLa cells were stained with STAT1 rabbit purified polyclonal 1:1200 and STAT5A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-STAT5A antibody
Two highly related, but distinct STAT5 genes (STAT5a and STAT5b) were identified in mice. The aa sequences of Stat5a and Stat5b show approximately 96% sequence similarity, and both proteins are co-expressed in most tissues of both virgin and lactating mice. However, differential accumulation of STAT5a and STAT5b in mRNA has been reported for both muscle and mammary tissue. STAT5 has been shown to be the essential mediator of prolactin induced milk protein gene activation. This antibody detects Stat5 a/b.
Product Categories/Family for anti-STAT5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
90,647 Da
NCBI Official Full Name
Homo sapiens signal transducer and activator of transcription 5A, mRNA
NCBI Official Synonym Full Names
signal transducer and activator of transcription 5A
NCBI Official Symbol
STAT5A
NCBI Official Synonym Symbols
MGF; STAT5
NCBI Protein Information
signal transducer and activator of transcription 5A
UniProt Protein Name
Signal transducer and activator of transcription 5A
UniProt Gene Name
STAT5A
UniProt Synonym Gene Names
STAT5
UniProt Entry Name
STA5A_HUMAN

Uniprot Description

STAT5A: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of many cytokines and growth-factor receptors. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 fusion protein is essential for the tumorigenesis. Induces the expression of BCL2L1/BCL-X(L) in the mouse, suggesting an antiapoptotic function of this protein. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; Oncoprotein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; cytosol

Molecular Function: signal transducer activity; protein binding; transcription factor activity

Biological Process: lactation; succinate metabolic process; peptidyl-tyrosine phosphorylation; oxaloacetate metabolic process; positive regulation of interleukin-2 biosynthetic process; T cell differentiation in the thymus; female pregnancy; positive regulation of multicellular organism growth; fatty acid metabolic process; positive regulation of mitotic cell cycle; positive regulation of activated T cell proliferation; 2-oxoglutarate metabolic process; positive regulation of natural killer cell differentiation; sequestering of lipid; negative regulation of mast cell apoptosis; natural killer cell differentiation; allantoin metabolic process; luteinization; development of secondary male sexual characteristics; regulation of steroid metabolic process; creatinine metabolic process; T cell homeostasis; positive regulation of gamma-delta T cell differentiation; Peyer's patch development; isoleucine metabolic process; negative regulation of erythrocyte differentiation; transcription, DNA-dependent; valine metabolic process; citrate metabolic process; regulation of multicellular organism growth; development of secondary female sexual characteristics; JAK-STAT cascade; positive regulation of natural killer cell mediated cytotoxicity; creatine metabolic process; regulation of transcription from RNA polymerase II promoter; regulation of epithelial cell differentiation; positive regulation of B cell differentiation; positive regulation of transcription from RNA polymerase II promoter; taurine metabolic process; positive regulation of inflammatory response

Similar Products

Product Notes

The STAT5A stat5a (Catalog #AAA6149927) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAT5A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAT5A stat5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT5A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.