Mouse anti-Human STAT3 Monoclonal Antibody | anti-STAT3 antibody

STAT3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063) (PE)

Cat. Num. AAA6160532

• Gene Names: STAT3; APRF; HIES; ADMIO
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STAT3; Monoclonal Antibody; STAT3 (Signal Transducer and Activator of Transcription 3; Acute-phase Response Factor; APRF; FLJ20882; MGC16063) (PE); anti-STAT3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4D6
• Specificity: Recognizes human STAT3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-STAT3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa670-769 from human STAT3 (NP_003141) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(STAT3 monoclonal antibody, Western Blot analysis of STAT3 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged STAT3 is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NFKB1 and STAT3 HeLa cells were stained with NFKB1 rabbit purified polyclonal 1:1200 and STAT3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-STAT3 antibody

Antibodies; Transcription Factors; STAT

NCBI and Uniprot Product Information

• NCBI GI #: 21618338
• NCBI GeneID: 6774
• NCBI Accession #: NP_003141
• NCBI GenBank Nucleotide #: NM_003150
• UniProt Accession #: P40763; O14916; Q9BW54; A8K7B8; K7ENL3
• Molecular Weight: 83,126 Da
• NCBI Official Full Name: signal transducer and activator of transcription 3 isoform 2
• NCBI Official Synonym Full Names: signal transducer and activator of transcription 3 (acute-phase response factor)
• NCBI Official Symbol: STAT3
• NCBI Official Synonym Symbols: APRF; HIES; ADMIO
• NCBI Protein Information: signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor
• UniProt Protein Name: Signal transducer and activator of transcription 3
• Protein Family: Signal transducer and activator of transcription
• UniProt Gene Name: STAT3
• UniProt Synonym Gene Names: APRF
• UniProt Entry Name: STAT3_HUMAN

Uniprot Description

STAT3: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of many cytokines and growth-factor receptors. Constitutively active in a number of human tumors. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; Nuclear receptor co-regulator; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; cytoplasm; mitochondrial inner membrane; plasma membrane; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; ligand-dependent nuclear receptor activity; signal transducer activity; DNA binding; sequence-specific DNA binding; protein kinase binding; transcription factor binding; protein phosphatase binding; transcription factor activity; CCR5 chemokine receptor binding; glucocorticoid receptor binding

Biological Process: transcription from RNA polymerase II promoter; nerve growth factor receptor signaling pathway; viral reproduction; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; radial glial cell differentiation; thermoregulation; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; signal transduction; response to estradiol stimulus; negative regulation of cell proliferation; astrocyte differentiation; regulation of transcription, DNA-dependent; protein import into nucleus; acute-phase response; negative regulation of glycolysis; positive regulation of Notch signaling pathway; response to drug; nervous system development; intracellular receptor-mediated signaling pathway; eating behavior; cytokine and chemokine mediated signaling pathway; regulation of multicellular organism growth; JAK-STAT cascade; cellular response to hormone stimulus; regulation of transcription from RNA polymerase II promoter; cell proliferation; response to ethanol; sexual reproduction; positive regulation of transcription from RNA polymerase II promoter; eye photoreceptor cell differentiation; cell motility; phosphorylation

Disease: Hyper-ige Recurrent Infection Syndrome, Autosomal Dominant; Autoimmune Disease, Multisystem, Infantile-onset