Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human STAT1 Monoclonal Antibody | anti-STAT1 antibody

STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, DKFZp686B04100) APC

Gene Names
STAT1; CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STAT1; Monoclonal Antibody; STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta; Transcription Factor ISGF-3 Components p91/p84; DKFZp686B04100) APC; anti-STAT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes human STAT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-STAT1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 40ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa613-712 from human STAT1 (AAH02704) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(STAT1 monoclonal antibody, A8 Western Blot analysis of STAT1 expression in HeLa.)

Western Blot (WB) (STAT1 monoclonal antibody, A8 Western Blot analysis of STAT1 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT1 on HeLa cell. [antibody concentration 40ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAT1 on HeLa cell. [antibody concentration 40ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged STAT1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STAT1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-STAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
83,043 Da
NCBI Official Full Name
Homo sapiens signal transducer and activator of transcription 1, 91kDa, mRNA
NCBI Official Synonym Full Names
signal transducer and activator of transcription 1, 91kDa
NCBI Official Symbol
STAT1
NCBI Official Synonym Symbols
CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
NCBI Protein Information
signal transducer and activator of transcription 1-alpha/beta; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription-1; transcription factor ISGF-3 components p91/p84
UniProt Protein Name
Signal transducer and activator of transcription 1-alpha/beta
UniProt Gene Name
STAT1
UniProt Entry Name
STAT1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

STAT1: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of certain receptor tyrosine kinases, GPCRs, and receptors for various interleukins and interferons. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2q32.2

Cellular Component: nucleoplasm; axon; nuclear chromatin; cytoplasm; dendrite; nucleolus; cytosol; nucleus

Molecular Function: identical protein binding; signal transducer activity; protein binding; protein homodimerization activity; enzyme binding; double-stranded DNA binding; transcription factor activity; tumor necrosis factor receptor binding; CCR5 chemokine receptor binding

Biological Process: transcription from RNA polymerase II promoter; response to peptide hormone stimulus; response to cAMP; viral reproduction; blood circulation; apoptosis; positive regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; negative regulation of transcription from RNA polymerase II promoter; regulation of apoptosis; response to exogenous dsRNA; tumor necrosis factor-mediated signaling pathway; positive regulation of mesenchymal cell proliferation; negative regulation of viral protein levels in host cell; lipopolysaccharide-mediated signaling pathway; defense response to virus; response to nutrient; response to drug; cytokine and chemokine mediated signaling pathway; negative regulation of I-kappaB kinase/NF-kappaB cascade; JAK-STAT cascade; regulation of transcription from RNA polymerase II promoter; negative regulation of angiogenesis; response to hydrogen peroxide; cellular response to insulin stimulus; response to mechanical stimulus; response to cytokine stimulus; negative regulation of endothelial cell proliferation; endothelial cell migration; positive regulation of transcription from RNA polymerase II promoter

Disease: Immunodeficiency 31a; Immunodeficiency 31b; Immunodeficiency 31c

Research Articles on STAT1

Similar Products

Product Notes

The STAT1 stat1 (Catalog #AAA6139318) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAT1 (Signal Transducer and Activator of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, DKFZp686B04100) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 40ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAT1 stat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.