Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Mouse anti-Human SS18 Monoclonal Antibody | anti-SS18 antibody

SS18 (Protein SSXT, Protein SYT, Synovial Sarcoma Translocated to X Chromosome Protein, SSXT, SYT, MGC116875) (AP)

Gene Names
SS18; SYT; SSXT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SS18; Monoclonal Antibody; SS18 (Protein SSXT; Protein SYT; Synovial Sarcoma Translocated to X Chromosome Protein; SSXT; SYT; MGC116875) (AP); anti-SS18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Specificity
Recognizes human SS18.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SS18 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa116-217 from human SS18 (NP_001007560) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYN*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Testing Data

(Detection limit for recombinant GST tagged SS18 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SS18 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-SS18 antibody
Appears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation.
Product Categories/Family for anti-SS18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,929 Da
NCBI Official Full Name
protein SSXT isoform 1
NCBI Official Synonym Full Names
synovial sarcoma translocation, chromosome 18
NCBI Official Symbol
SS18
NCBI Official Synonym Symbols
SYT; SSXT
NCBI Protein Information
protein SSXT; synovial sarcoma, translocated to X chromosome; synovial sarcoma translocated to X chromosome protein
UniProt Protein Name
Protein SSXT
Protein Family
UniProt Gene Name
SS18
UniProt Synonym Gene Names
SSXT; SYT
UniProt Entry Name
SSXT_HUMAN

Uniprot Description

SS18: Appears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation. A chromosomal aberration involving SS18 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency). Belongs to the SS18 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: cytoplasmic microtubule; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity

Biological Process: response to drug; transcription, DNA-dependent; cell morphogenesis; ephrin receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; microtubule cytoskeleton organization and biogenesis

Research Articles on SS18

Similar Products

Product Notes

The SS18 ss18 (Catalog #AAA6133983) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SS18 (Protein SSXT, Protein SYT, Synovial Sarcoma Translocated to X Chromosome Protein, SSXT, SYT, MGC116875) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SS18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SS18 ss18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SS18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.