Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SRM is 1ng/ml as a capture antibody)

Mouse anti-Human SRM Monoclonal Antibody | anti-SRM antibody

SRM (Spermidine Synthase, SPDSY, Putrescine Aminopropyltransferase, SPS1, SRML1) (HRP)

Gene Names
SRM; PAPT; SPS1; SPDSY; SRML1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRM; Monoclonal Antibody; SRM (Spermidine Synthase; SPDSY; Putrescine Aminopropyltransferase; SPS1; SRML1) (HRP); anti-SRM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C1
Specificity
Recognizes human SRM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SRM antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa203-302 from human SRM (AAH00309) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDV*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SRM is 1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged SRM is 1ng/ml as a capture antibody)
Related Product Information for anti-SRM antibody
Required for normal viability, growth and fertility.
Product Categories/Family for anti-SRM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33,825 Da
NCBI Official Full Name
Homo sapiens spermidine synthase, mRNA
NCBI Official Synonym Full Names
spermidine synthase
NCBI Official Symbol
SRM
NCBI Official Synonym Symbols
PAPT; SPS1; SPDSY; SRML1
NCBI Protein Information
spermidine synthase
UniProt Protein Name
Spermidine synthase
UniProt Gene Name
SRM
UniProt Synonym Gene Names
SPS1; SRML1; SPDSY
UniProt Entry Name
SPEE_HUMAN

NCBI Description

The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor. [provided by RefSeq, Jul 2008]

Uniprot Description

SRM: Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine. Belongs to the spermidine/spermine synthase family.

Protein type: Amino Acid Metabolism - arginine and proline; Other Amino Acids Metabolism - glutathione; EC 2.5.1.16; Amino Acid Metabolism - cysteine and methionine; Other Amino Acids Metabolism - beta-alanine; Transferase

Chromosomal Location of Human Ortholog: 1p36-p22

Cellular Component: cytosol

Molecular Function: protein homodimerization activity; spermidine synthase activity

Biological Process: spermidine biosynthetic process; polyamine metabolic process

Research Articles on SRM

Similar Products

Product Notes

The SRM srm (Catalog #AAA6155190) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SRM (Spermidine Synthase, SPDSY, Putrescine Aminopropyltransferase, SPS1, SRML1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRM can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRM srm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.