Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human SPR Monoclonal Antibody | anti-SPR antibody

SPR (Sepiapterin Reductase (7,8-Dihydrobiopterin:NADP+ Oxidoreductase, SDR38C1) (Biotin)

Gene Names
SPR; SDR38C1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPR; Monoclonal Antibody; SPR (Sepiapterin Reductase (7; 8-Dihydrobiopterin:NADP+ Oxidoreductase; SDR38C1) (Biotin); anti-SPR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F2
Specificity
Recognizes human SPR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SPR antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa164-261 from human SPR (NP_003115) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB)

(Western Blot analysis of SPR expression in transfected 293T cell line by SPR monoclonal antibody. Lane 1: SPR transfected lysate (28kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPR expression in transfected 293T cell line by SPR monoclonal antibody. Lane 1: SPR transfected lysate (28kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SPR transfected lysate using SPR monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SPR rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SPR transfected lysate using SPR monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SPR rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SPR is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPR is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SPR antibody
SPR encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1.
Product Categories/Family for anti-SPR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.2 kDa (281aa), confirmed by MALDI-TOF.
NCBI Official Full Name
sepiapterin reductase
NCBI Official Synonym Full Names
sepiapterin reductase
NCBI Official Symbol
SPR
NCBI Official Synonym Symbols
SDR38C1
NCBI Protein Information
sepiapterin reductase
UniProt Protein Name
Sepiapterin reductase
Protein Family
UniProt Gene Name
SPR
UniProt Synonym Gene Names
SPR
UniProt Entry Name
SPRE_HUMAN

NCBI Description

This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

SPR: Catalyzes the final one or two reductions in tetra- hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin. Defects in SPR are the cause of dystonia DOPA-responsive due to sepiapterin reductase deficiency (DRDSPRD). In the majority of cases, patients manifest progressive psychomotor retardation, dystonia and spasticity. Cognitive anomalies are also often present. The disease is due to severe dopamine and serotonin deficiencies in the central nervous system caused by a defect in BH4 synthesis. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Belongs to the sepiapterin reductase family.

Protein type: Cofactor and Vitamin Metabolism - folate biosynthesis; EC 1.1.1.153; Oxidoreductase

Chromosomal Location of Human Ortholog: 2p14-p12

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; cytosol

Molecular Function: aldo-keto reductase activity; sepiapterin reductase activity; NADP binding

Biological Process: L-phenylalanine metabolic process; tetrahydrobiopterin biosynthetic process; voluntary musculoskeletal movement; death; pteridine metabolic process; neuron morphogenesis during differentiation; regulation of multicellular organism growth; regulation of nitric-oxide synthase activity; nitric oxide biosynthetic process; norepinephrine metabolic process; dopamine metabolic process; nitric oxide metabolic process; serotonin metabolic process

Disease: Dystonia, Dopa-responsive, Due To Sepiapterin Reductase Deficiency

Research Articles on SPR

Similar Products

Product Notes

The SPR spr (Catalog #AAA6144565) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPR (Sepiapterin Reductase (7,8-Dihydrobiopterin:NADP+ Oxidoreductase, SDR38C1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPR spr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.