Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SPP1 expression in transfected 293T cell line by SPP1 monoclonal antibody (M16), clone 1D7.Lane 1: SPP1 transfected lysate (35.4 KDa).Lane 2: Non-transfected lysate.)

Mouse SPP1 Monoclonal Antibody | anti-SPP1 antibody

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (HRP)

Gene Names
SPP1; OPN; BNSP; BSPI; ETA-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SPP1; Monoclonal Antibody; SPP1 (Secreted Phosphoprotein 1; BNSP; BSPI; ETA-1; MGC110940; OPN) (HRP); Secreted Phosphoprotein 1; OPN; anti-SPP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes SPP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SPP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SPP1 (NP_000573.1, 21aa-129aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SPP1 expression in transfected 293T cell line by SPP1 monoclonal antibody (M16), clone 1D7.Lane 1: SPP1 transfected lysate (35.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPP1 expression in transfected 293T cell line by SPP1 monoclonal antibody (M16), clone 1D7.Lane 1: SPP1 transfected lysate (35.4 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,423 Da
NCBI Official Full Name
osteopontin isoform OPN-b
NCBI Official Synonym Full Names
secreted phosphoprotein 1
NCBI Official Symbol
SPP1
NCBI Official Synonym Symbols
OPN; BNSP; BSPI; ETA-1
NCBI Protein Information
osteopontin; uropontin; nephropontin; SPP1/CALPHA1 fusion; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I,
UniProt Protein Name
Osteopontin
Protein Family
UniProt Gene Name
SPP1
UniProt Synonym Gene Names
BNSP; OPN; SPP-1
UniProt Entry Name
OSTP_HUMAN

NCBI Description

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

osteopontin: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Belongs to the osteopontin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: extracellular space; cell projection; perinuclear region of cytoplasm; apical part of cell; extracellular region

Molecular Function: protein binding; extracellular matrix binding; cytokine activity

Biological Process: neutrophil chemotaxis; extracellular matrix organization and biogenesis; decidualization; osteoblast differentiation; extracellular matrix disassembly; response to vitamin D; biomineral formation; response to steroid hormone stimulus; negative regulation of collateral sprouting of intact axon in response to injury; positive regulation of bone resorption; inflammatory response; cell adhesion; embryo implantation

Research Articles on SPP1

Similar Products

Product Notes

The SPP1 spp1 (Catalog #AAA6182476) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SPP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPP1 spp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.