Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (39.31kD).)

Mouse anti-Human, Mouse SPI1 Monoclonal Antibody | anti-SPI1 antibody

SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) APC

Gene Names
SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPI1; Monoclonal Antibody; SPI1 (Transcription Factor PU.1; 31kD-transforming Protein) APC; anti-SPI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G1
Specificity
Recognizes human SPI1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SPI1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-121 from human SPI1 (NP_003111) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.31kD).)

Western Blot (WB) (Western Blot detection against Immunogen (39.31kD).)

Western Blot (WB)

(SPI1 monoclonal antibody. Western Blot analysis of SPI1 expression in Raw 264.7.)

Western Blot (WB) (SPI1 monoclonal antibody. Western Blot analysis of SPI1 expression in Raw 264.7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SPI1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SPI1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SPI1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPI1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SPI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
transcription factor PU.1 isoform 2
NCBI Official Synonym Full Names
Spi-1 proto-oncogene
NCBI Official Symbol
SPI1
NCBI Official Synonym Symbols
OF; PU.1; SFPI1; SPI-1; SPI-A
NCBI Protein Information
transcription factor PU.1
UniProt Protein Name
Transcription factor PU.1
Protein Family
UniProt Gene Name
SPI1
UniProt Entry Name
SPI1_HUMAN

NCBI Description

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PU.1: Binds to the PU-box, a purine-rich DNA sequence (5'- GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B- cells. Also binds RNA and may modulate pre-mRNA splicing. Binds DNA as a monomer. Interacts with CEBPD and NONO. Interacts with RUNX1 and SPIB. Interacts with GFI1; the interaction represses SPI1 transcriptional activity. Highly expressed in both FV-P and FV-A-induced erythro- leukemia cell lines that have undergone rearrangements of the Spi- 1 gene due to the insertion of SFFV. Belongs to the ETS family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: nuclear chromatin

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; NFAT protein binding; RNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; macrophage differentiation; granulocyte differentiation; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; lymphoid progenitor cell differentiation; myeloid dendritic cell differentiation; negative regulation of transcription from RNA polymerase II promoter; anatomical structure regression; regulation of transcription from RNA polymerase II promoter; regulation of erythrocyte differentiation; lymphocyte differentiation; negative regulation of gene expression, epigenetic; negative regulation of MHC class II biosynthetic process; erythrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on SPI1

Similar Products

Product Notes

The SPI1 spi1 (Catalog #AAA6139255) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SPI1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPI1 spi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.