Mouse anti-Human, Mouse SPI1 Monoclonal Antibody | anti-SPI1 antibody

SPI1 (Transcription Factor PU.1, 31kD-transforming Protein) APC

Cat. Num. AAA6139255

• Gene Names: SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A
• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SPI1; Monoclonal Antibody; SPI1 (Transcription Factor PU.1; 31kD-transforming Protein) APC; anti-SPI1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G1
• Specificity: Recognizes human SPI1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SPI1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-121 from human SPI1 (NP_003111) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.31kD).)

Western Blot (WB)

(SPI1 monoclonal antibody. Western Blot analysis of SPI1 expression in Raw 264.7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SPI1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SPI1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SPI1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 124028517
• NCBI GeneID: 6688
• NCBI Accession #: NP_003111
• NCBI GenBank Nucleotide #: NM_003120
• UniProt Accession #: P17947
• Molecular Weight: 30kDa
• NCBI Official Full Name: transcription factor PU.1 isoform 2
• NCBI Official Synonym Full Names: Spi-1 proto-oncogene
• NCBI Official Symbol: SPI1
• NCBI Official Synonym Symbols: OF; PU.1; SFPI1; SPI-1; SPI-A
• NCBI Protein Information: transcription factor PU.1
• UniProt Protein Name: Transcription factor PU.1
• Protein Family: Transcription factor
• UniProt Gene Name: SPI1
• UniProt Entry Name: SPI1_HUMAN

NCBI Description

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PU.1: Binds to the PU-box, a purine-rich DNA sequence (5'- GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B- cells. Also binds RNA and may modulate pre-mRNA splicing. Binds DNA as a monomer. Interacts with CEBPD and NONO. Interacts with RUNX1 and SPIB. Interacts with GFI1; the interaction represses SPI1 transcriptional activity. Highly expressed in both FV-P and FV-A-induced erythro- leukemia cell lines that have undergone rearrangements of the Spi- 1 gene due to the insertion of SFFV. Belongs to the ETS family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: nuclear chromatin

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; NFAT protein binding; RNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; macrophage differentiation; granulocyte differentiation; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; lymphoid progenitor cell differentiation; myeloid dendritic cell differentiation; negative regulation of transcription from RNA polymerase II promoter; anatomical structure regression; regulation of transcription from RNA polymerase II promoter; regulation of erythrocyte differentiation; lymphocyte differentiation; negative regulation of gene expression, epigenetic; negative regulation of MHC class II biosynthetic process; erythrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent