Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (81.22kD).)

Mouse anti-Human SPAG8 Monoclonal Antibody | anti-SPAG8 antibody

SPAG8 (Sperm-associated Antigen 8, HSD-1, Sperm Membrane Protein 1, SMP1, SMP-1, hSMP-1, Sperm Membrane Protein BS-84) (PE)

Gene Names
SPAG8; SMP1; BS-84; CT142; HSD-1; SPAG3; CILD28; hSMP-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPAG8; Monoclonal Antibody; SPAG8 (Sperm-associated Antigen 8; HSD-1; Sperm Membrane Protein 1; SMP1; SMP-1; hSMP-1; Sperm Membrane Protein BS-84) (PE); SPAG3; anti-SPAG8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F12
Specificity
Recognizes human SPAG8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SPAG8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-502 from human SPAG8 (AAH19247) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
METNGSTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPGSSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVLNYTSWSQHCPWEPQKQPPWEFLQVLEPGA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (81.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (81.22kD).)

Western Blot (WB)

(Western Blot analysis of SPAG8 expression in transfected 293T cell line by SPAG8 monoclonal antibody. Lane 1: SPAG8 transfected lysate (53.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPAG8 expression in transfected 293T cell line by SPAG8 monoclonal antibody. Lane 1: SPAG8 transfected lysate (53.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SPAG8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
51,139 Da
NCBI Official Full Name
Homo sapiens sperm associated antigen 8, mRNA
NCBI Official Synonym Full Names
sperm associated antigen 8
NCBI Official Symbol
SPAG8
NCBI Official Synonym Symbols
SMP1; BS-84; CT142; HSD-1; SPAG3; CILD28; hSMP-1
NCBI Protein Information
sperm-associated antigen 8
Protein Family

NCBI Description

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein encoded by this gene is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa. This protein interacts with ACT (activator of CREM in testis) and may play a role in CREM (cAMP response element modulator)-ACT-mediated gene transcription during spermatogenesis. This protein may also play a role in spermatogenesis by regulating microtubule formation and cell division. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined. [provided by RefSeq, Jul 2012]

Research Articles on SPAG8

Similar Products

Product Notes

The SPAG8 (Catalog #AAA6160458) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPAG8 (Sperm-associated Antigen 8, HSD-1, Sperm Membrane Protein 1, SMP1, SMP-1, hSMP-1, Sperm Membrane Protein BS-84) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPAG8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPAG8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPAG8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.