Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SOX4 is 0.03 ng/ml as a capture antibody.)

Mouse SOX4 Monoclonal Antibody | anti-SOX4 antibody

SOX4 (SRY (Sex Determining Region Y)-Box 4, EVI16) (PE)

Gene Names
SOX4; EVI16
Applications
ELISA
Purity
Purified
Synonyms
SOX4; Monoclonal Antibody; SOX4 (SRY (Sex Determining Region Y)-Box 4; EVI16) (PE); SRY (Sex Determining Region Y)-Box 4; EVI16; anti-SOX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
100000
Specificity
Recognizes SOX4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SOX4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SOX4 (NP_003098, 45aa-136aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SOX4 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SOX4 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-SOX4 antibody
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. [provided by RefSeq]
Product Categories/Family for anti-SOX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 52 kDa

Observed: 520 kDa
NCBI Official Full Name
transcription factor SOX-4
NCBI Official Synonym Full Names
SRY (sex determining region Y)-box 4
NCBI Official Symbol
SOX4
NCBI Official Synonym Symbols
EVI16
NCBI Protein Information
transcription factor SOX-4; SRY-related HMG-box gene 4; ecotropic viral integration site 16
UniProt Protein Name
Transcription factor SOX-4
Protein Family
UniProt Gene Name
SOX4
UniProt Entry Name
SOX4_HUMAN

NCBI Description

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX4: Transcriptional activator that binds with high affinity to the T-cell enhancer motif 5'-AACAAAG-3' motif.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleus

Molecular Function: protein binding; protein heterodimerization activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of protein export from nucleus; positive regulation of translation; somatic stem cell maintenance; positive regulation of apoptosis; heart development; positive regulation of transcription, DNA-dependent; regulation of protein stability; Wnt receptor signaling pathway through beta-catenin; glucose homeostasis; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; glial cell proliferation; negative regulation of cell proliferation; sympathetic nervous system development; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of Wnt receptor signaling pathway; skeletal development; T cell differentiation; glial cell development; pro-B cell differentiation; protein stabilization; positive regulation of insulin secretion; DNA damage response, detection of DNA damage; spinal cord motor neuron differentiation; endocrine pancreas development; limb bud formation; spinal cord development; negative regulation of protein ubiquitination; positive regulation of transcription from RNA polymerase II promoter; neural tube formation

Research Articles on SOX4

Similar Products

Product Notes

The SOX4 sox4 (Catalog #AAA6187166) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SOX4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOX4 sox4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.